DOI: /10.25592/dgs.corpus-3.0-type-14891

AFTERWARDS1A^


148
frontal
45°
90°
from above
AFTERWARDS1A^
Berlin | dgskorpus_ber_03 | 46-60f   He gave me a questioning look, and it was then that I realized that he hadn’t heard about it yet. So I told him about the atomic explosion.
rWHAT1B*AFTERWARDS1A^WHAT1B*$GEST-NM^NOT-YET2*
l
mwas[MG]noch nicht
Berlin | dgskorpus_ber_04 | 46-60m   At my last Deaflympics in Los Angeles ’89 [sic], I played water polo.
rOUTDOORS1B^*LAST2A*THEN1CAFTERWARDS1A^$ALPHA1:L-ATHERE1$NUM-ONE-TO-TEN1A:2d*
l
mletztedann??laneun{und}achtzig
Berlin | dgskorpus_ber_07 | 31-45m   I went there and worked there.
rAFTERWARDS1A^INTO2*TO-SUPERVISE2APLEASANT2
l
m[MG]betreuen betreuenangenehm
Berlin | dgskorpus_ber_08 | 46-60f   After the failed test we would have had to go to school for another half year.
rEXTENSION1BHALF-A-YEAR1
lI1AFTERWARDS1A^
mnoch malverlängernhalbjahr
Berlin | dgskorpus_ber_13 | 31-45f   So, I‘d recommend buying now, because they might be sold out pretty soon.
rCAN2B*IT-HAPPENS3SOMETIME1*AFTERWARDS1A^SOMETIME1*FAST3ASOLD-OUT1
l
mkannpassieren[MG]schnellausver{kauft}
Frankfurt | dgskorpus_fra_09 | 31-45m   The Convention on the Rights for Persons with Disabilities includes the accessibility to communication. Yet, the right to sue is missing.
rLAW-OR-JUSTICE1AFTERWARDS1A^THROUGH1^*COMMUNICATION1A$MORPH-UN5
l
mrechtaufzugangkommunikationu-n
Frankfurt | dgskorpus_fra_12 | 61+m   I heard that the train was going to Frankfurt Main.
rTRAIN2AAFTER2AFRANKFURT1*AFTERWARDS1A^SASH1B^ATTENTION1A^*OFF2^
l
mzugnachfrankfurt am main
Göttingen | dgskorpus_goe_04 | 31-45m   It was raised around the turn of the year 1988 to 1989.
r$GEST-NM-NOD-HEAD1^$NUM-ONE-TO-TEN1D:9*$NUM-DOUBLE1A:8d*AFTERWARDS1A^$NUM-ONE-TO-TEN1D:9*$NUM-TENS1:8d*TO-MODIFY2
l
machtundachtzigaufneunundachtzigveränderung
Göttingen | dgskorpus_goe_07 | 18-30m   Not always.
rAFTERWARDS1A^
l
mmanchmal
Göttingen | dgskorpus_goe_10 | 46-60m   Is it a regular event that takes place every four or five years or just rarely taking place?
rAFTERWARDS1A^PROCEEDING1^*TO-COME1*$NUM-YEAR-AFTER-NOW1:4
l
mkommen kommvier stun{de}
Bremen | dgskorpus_hb_01 | 31-45m   Then you want to order one or two interpreters. But they don't want to take the time to come to my workplace and by then the issue has been resolved already.
rDONT-FEEL-LIKE-IT1*TIME1WHEN1*NEW1A*SUBJECT1DISSOLUTION1A^
lAFTERWARDS1A^
m[MG]zeitwannneuthema[MG]
Bremen | dgskorpus_hb_01 | 31-45m   It takes place twice a year - once in April or May, and once in October or November.
rAPRIL2APPROXIMATELY2AFTERWARDS1A^NOVEMBER7*OCTOBER16BETWEEN1B*
lBETWEEN1B*
maprilundnovemberoktober
Bremen | dgskorpus_hb_03 | 31-45f   A lot of children get their CI implanted right after their birth.
rCI1FROM-OR-BY-OR-OF2BIRTH1AAFTERWARDS1A^CI1*
l
mvon[MG]gleich
Bremen | dgskorpus_hb_05 | 61+f   One year to go until I'm 65, I'm 64 now.
rSTILL5AFTERWARDS1A^YEAR1A*
l
mnochein jahr
Bremen | dgskorpus_hb_06 | 31-45f   When asked to work in the 30th floor again, I'd say no.
rONCE-AGAIN2B*AFTERWARDS1A^OFFICE2*ONCE-AGAIN2A*$NUM-TENS2A:3d
l
mnoch malbüronoch maldreißig
Hamburg | dgskorpus_hh_01 | 61+m   So I told the deaf person that the recipe wasn't working and that the icing disappeared.
rAFTERWARDS1A^DEAF-MUTE1*I2TO-LET-KNOW1A*
l
mtaubstumm
Hamburg | dgskorpus_hh_06 | 61+f   It was like that for some time and then it just ran low. Sad, actually.
rAFTERWARDS1A^SOMEWHERE1^*DISSOLUTION1D^TOO-BAD1*
l
m[MG][MG]schade
Hamburg | dgskorpus_hh_06 | 61+f   I thought the memory would fade and was surprised that it didn't.
rNO3B^*SILENT3STILL4A*AFTERWARDS1A^MEMORY-OR-REMINDER3A*ON-PERSON1I1
l
mbissch{en}stillnoch nocherinnerung erinnerung
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   Therefore I was done then.
rAFTERWARDS1A^DONE1B
l
m
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   And I will get another sister towards the end of november.
rI2NOW3*AFTERWARDS1A^NOVEMBER7*END6AFTERWARDS1A^
l
mich[MG]novemberendebekomme
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   And I will get another sister towards the end of november.
rAFTERWARDS1A^NOVEMBER7*END6AFTERWARDS1A^NEW4ASISTER1A*I1
l
m[MG]novemberendebekommeneuschwesterich
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   And I will get another sister towards the end of november.
rNEW4ASISTER1A*I1AFTERWARDS1A^
l
mneuschwesterich[MG]
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   Then you move up to Miss International.
rAFTERWARDS1A^$LIST1:3of4MISS1*INTERNATIONAL1
l
mmissinternational
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Yes, you should talk to her soon.
rYES1ATALK2A$GEST-OFF^*AFTERWARDS1A^
l
m[MG][MG][MG]
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   One has to wait and see what it’s like after.
rTO-WAIT1C^AFTERWARDS1A^TO-SEE1*$INDEX1
l
mgleichbis[MG]
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   You can get from my house to Winterberg very easily.
rAFTERWARDS1A^I1SELF1A*HERE1
l
mauchselberhier
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   I would like there to be another demonstration for another topic in Erfurt as well.
rI1*TO-WISH1BAFTERWARDS1A^ERFURT1*ALSO1ADEMONSTRATION1
l
mwunschinerfurtauchdemo
Leipzig | dgskorpus_lei_01 | 18-30m   If you order an interpreter, it's a different one every time and they always have to adjust to communication first.
rIF-OR-WHEN1A*INTERPRETER1*$PRODAFTERWARDS1A^DIFFERENT1*TO-HIRE1A*DIFFERENT1*
l
mwenndolmetschermaland{erer}anders
Leipzig | dgskorpus_lei_07 | 46-60f   I was then enrolled in first grade.
r$PRODTO-OBTAIN1*
lLATER10*$INDEX1AFTERWARDS1A^$NUM-GRADE1:1d
mklasseeins[MG]
Leipzig | dgskorpus_lei_07 | 46-60f   He said he needed me after 10th grade.
r$INDEX1TO-LET-KNOW1A*TO-NEED1AFTERWARDS1A^$NUM-GRADE1:10PLEASE2^$INDEX1
l
mbrauchenbisklasse[MG]
Leipzig | dgskorpus_lei_11 | 31-45f   There is something else in Leipzig.
rAND5AFTERWARDS1A^$LIST1:2of2dALSO1A
l
mundauch
Leipzig | dgskorpus_lei_11 | 31-45f   If we had goose one year, we are having duck the next.
rATTENTION1A^*NOT3AAFTERWARDS1A^GOOSE2THEN1ADUCK2
l
mein jahrgansente
Münster | dgskorpus_mst_03 | 18-30f   When the year goes by so fast you have more time to yourself, can take your time and enjoy the time you have.
rIF-OR-WHEN1A*YEAR2BFAST3AAFTERWARDS1A^MEANING1ALSO1AFOR1
l
mwennjahrschnellumbedeutetauchfür
Münster | dgskorpus_mst_08 | 61+f   We stayed there until one or two o’clock in the morning and then went home.
rUNTIL-NOW1TOMORROW1APROCEEDING1^*AFTERWARDS1A^$NUM-CLOCK1A:1d$NUM-CLOCK1A:2d*GO-HOME2*
l
mmorgenein uhrzwei uhrnach hause
Münster | dgskorpus_mst_11 | 61+m   But I continued crying and saying I was feeling homesick.
rI1TO-CRY1*AFTERWARDS1A^TO-CRY1*HOMESICKNESS3$GEST-OFF^*
l
m[MG]weiter weiterweinenheimweh
Münster | dgskorpus_mst_11 | 61+m   I had food at my foster mother’s house and had to immediately do my homework.
rTO-EAT-OR-FOOD2*$INDEX1*AFTERWARDS1A^HOMEWORK1*
l$INDEX1
m[MG]gleichschulaufgaben schulaufg{aben}
Münster | dgskorpus_mst_13 | 46-60f   … until the first steps and the walking around.
rAFTERWARDS1A^FIRST-TIME3A*$PROD$PROD
l
mbiserste mallaufen laufen laufenum um um
Münster | dgskorpus_mst_16 | 61+m   “We’ll get there”, a teacher said.
rAFTERWARDS1A^TO-COME2*SLOW1*
l
mdaskommtlangsam
München (Munich) | dgskorpus_mue_01 | 61+f   If the two of us went to the senior meet-up now and again, that would make them happy.
rAFTERWARDS1A^BOTH1TO-VISIT-OR-TO-ATTEND1BAFTERWARDS1A^
l
mwennich wirsenioren[MG]
München (Munich) | dgskorpus_mue_01 | 61+f   If the two of us went to the senior meet-up now and again, that would make them happy.
rAFTERWARDS1A^BOTH1TO-VISIT-OR-TO-ATTEND1BAFTERWARDS1A^TO-MEET1*HAPPY1*OCCASIONALLY1*
l
mwennich wirsenioren[MG][MG]froh
München (Munich) | dgskorpus_mue_01 | 61+f   Yes, she has already fainted.
rYES1A*WAS1FAINT1AFTERWARDS1A^EXAMPLE1^*$INDEX1
l
mjawarohnmacht
München (Munich) | dgskorpus_mue_03 | 46-60m   A few members of our Sign choir “Singende Hände” [“Singing Hands”] agreed that we wanted to take a trip to Rome at some point, too.
rAFTERWARDS1A^I1TO-COME-INTO-MIND1*MUST1A^*
l
mich[MG]war
München (Munich) | dgskorpus_mue_04 | 18-30f   You are able to walk from the hotels to Disneyland.
rTHEN1AROUND4A^LOCATION1A^*AFTERWARDS1A^TO-GO1A^*MUST1TO-GO2^*
l
mdannhotel[MG][MG]
München (Munich) | dgskorpus_mue_04 | 18-30f   I would love to tour the world at some point.
rSTILL5EVERYTHING1B*GLADLY1AFTERWARDS1A^WORLD1*JOURNEY1B
l
mnochallesgernweltreise
München (Munich) | dgskorpus_mue_04 | 18-30f   We go camping or meet at a café.
r$GEST-OFF^*TENT1AFTERWARDS1A^COFFEE2ATO-SIGN1E^*
l
mzeltcafé
München (Munich) | dgskorpus_mue_04 | 18-30f   Most of the time we end up doing the same things.
rAFTERWARDS1A^MOST1ASIMILAR1*$INDEX1*
l
mmeistähnlich
München (Munich) | dgskorpus_mue_10 | 31-45m   I went there and it began.
rTO-GO-THERE2*GO-START1*I1AFTERWARDS1A^
l$GEST-DECLINE1^*
mlos
München (Munich) | dgskorpus_mue_13 | 46-60m   When I was two or three years old, my parents just didn’t know what to do with me.
rNOW1TO-COME1$NUM-ORDINAL1:2d*AFTERWARDS1A^$NUM-ONE-TO-TEN1A:2d$NUM-ONE-TO-TEN1A:3dOLD3
l
mjetztkommtkommtzwei jahre altdreijahr alt
München (Munich) | dgskorpus_mue_13 | 46-60m   We both had thought that I would have more time, but now it was supposed to start right away.
rTO-THINK1B*AFTERWARDS1A^TO-STAY2$GEST-NM-SHAKE-HEAD1^ALREADY1A
l
m[MG][MG][MG]neinschon
Rostock | dgskorpus_mvp_01 | 18-30m   What else should I talk about?
r$GEST-TO-FOLD-ONES-HANDS1^$GEST-OFF^$GEST-OFF^$GEST-OFF^$GEST-OFF^
lAFTERWARDS1A^
m
Rostock | dgskorpus_mvp_06 | 61+m   Think about that! 76 men are simply fired, and only four remain.
rTO-KNOW-OR-KNOWLEDGE2A^AFTERWARDS1A^$NUM-ONE-TO-TEN1A:6d$NUM-TENS2A:7dMAN10*
l
müberlegmalsechsundsiebzigmann
Rostock | dgskorpus_mvp_06 | 61+m   That was in 1990, and back then I thought they would fire me afterwards.
rI1TO-BELIEVE2BI1AFTERWARDS1A^$NUM-HUNDRED1$NUM-TENS2A:9$GEST-OFF^
l
mglaubeneunzig
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   It gets more and more expensive.
rAFTERWARDS1A^INCREASE2*
l
m[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   It was as though she only said it so it would be something positive and I would be happy, but in the end, oh well.
rLIKE4A*TO-TELL4*AFTERWARDS1A^I1POSITIVE1HAPPY1
l
mdamitpo{sit}ivfreu
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   So the organizers there could see who had free entry.
rAFTERWARDS1A^TO-SEE1*$INDEX1INTO2
l
mdamitsehendarein
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   One was allowed to enter with those.
rAFTERWARDS1A^INTO2ALLOWED5*
l
mdamitreindarf
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   Later on you should/
r$GEST-OFF^
lAFTERWARDS1A^
m
Stuttgart | dgskorpus_stu_06 | 18-30f   I need to polish it again soon.
rI1AFTERWARDS1A^TO-CLEAN3B*
l
mmuss[MG]
Stuttgart | dgskorpus_stu_08 | 61+f   But they go to Gaggenau, Brühl, and Haueneberstein until 7 pm.
r$ORAL^THEN1C*AND2A
lI1TO-PLACE1AFTERWARDS1A^PAST1^*
mnachgaggenaudannbühl
Stuttgart | dgskorpus_stu_15 | 61+f   On Monday I drove to work. It was there that my colleague approached me.
rTHEN1C*AFTERWARDS1A^MONDAY8BI1*TO-WORK1
l
mdann[MG]montagicharbeit
Berlin | dgskorpus_ber_02 | 46-60m   I went to a lot of parties. Thus, I was able to leave things behind and just forget about everything.
rTO-CELEBRATE1A^*LOOSE1*CARELESS3BAFTERWARDS1A^*TO-FORGET1^*OVER3*TO-DEVELOP2*
l
m[MG]v{erg}ess[MG]
Berlin | dgskorpus_ber_02 | 46-60m   Yugoslavia, and then/
rYUGOSLAVIA1*AFTERWARDS1A^*$GEST^
l
mjugoslawien
Berlin | dgskorpus_ber_04 | 46-60m   We went to vocational school once a week.
rPROFESSION1A*SCHOOL3*ALSO3AAFTERWARDS1A^*TIMES3*WEEK2*
l
mberufsschuleauchwocheeinmalwoche
Berlin | dgskorpus_ber_04 | 46-60m   I also won the German Soccer Championship with the Comet club once.
rAFTERWARDS1A^*$NUM-ONE-TO-TEN1A:1dFOOTBALL1A*AT-OR-ON1A*
l
mundauchfußballbei
Berlin | dgskorpus_ber_04 | 46-60m   Then there were the cross games.
rTO-CROSS2TO-PLAY1*TO-CHANGE2D^AFTERWARDS1A^*
l
mkreuzspiel
Berlin | dgskorpus_ber_04 | 46-60m   And the Sign Language Festival, hold on, I am mixing things up.
rAFTERWARDS1A^*GOLD3*HAND2*AND2A*
l
modergoldenhand
Berlin | dgskorpus_ber_04 | 46-60m   I work together with my work assistant. She attends meetings with me and interprets there for me, for instance.
rINTERPRETER1*ASSISTANCE1*AFTERWARDS1A^*
lTO-COME1*
mdolmetscher[MG]
Berlin | dgskorpus_ber_09 | 18-30f   And then/
r
lMUST1AFTERWARDS1A^*
mmuss
Frankfurt | dgskorpus_fra_02 | 31-45m   Hearing people are very used to putting one word right after the other in a paragraph.
rWORD2SENTENCE2AFTERWARDS1A^*
l$INDEX1*
msatz
Frankfurt | dgskorpus_fra_06 | 31-45f   Half a year later, I got an employment agreement at the company which I am currently employed at.
rTO-JOIN1A^*PROCEEDING2^HALF1BAFTERWARDS1A^*TO-WORK1CONTRACT1A*I1
l
m[MG]halbjahrarbeitsvertrag
Frankfurt | dgskorpus_fra_08 | 18-30f   Later, I communicated with friends using sign language and gestures.
rAFTERWARDS1A^*CHANGE-OF-SUBJECT1*THEN1A$GEST-OFF^*
l
mdanach
Frankfurt | dgskorpus_fra_11 | 18-30m   Automatically I got to know his friends and friends of friends.
r$INDEX1*HIS-HER1*FRIEND3*AFTERWARDS1A^*ALL1A^*
l
mfreunde[MG]
Frankfurt | dgskorpus_fra_12 | 61+m   But my father got called up and had to go to Poland because of a lack of people in leading positions there.
rAFTERWARDS1A^*THEN1AI1^FATHER7*
l
mvater
Göttingen | dgskorpus_goe_03 | 61+f   His brother had eleven children.
rBROTHER1C*$INDEX1*AFTERWARDS1A^*TO-HAVE-TO-OWN1*$NUM-TEEN2B:1dCHILD2*
l
mbruderhat schonelfkinder
Göttingen | dgskorpus_goe_07 | 18-30m   From time to time I go there, that’s enough for me.
rAFTERWARDS1A^*
lGOOD1*$GEST-DECLINE1^*ENOUGH2
m[MG]gut
Hamburg | dgskorpus_hh_04 | 46-60m   Then I have a look at my bill and compare it to statistics in the BILD newspaper [literally ‘Picture Newspaper,’ German tabloid].
rI1AFTERWARDS1A^*TO-CALCULATE1TO-SEND-OR-TO-DISPATCH2*I1
l
mrechnungschicken
Hamburg | dgskorpus_hh_05 | 31-45m   A little bit further, in the southeast, there’s another island called P-H-I P-H-I, that’s the sign for it, PHI PHI.
rAND2A*AFTERWARDS1A^*DIFFERENT1*ISLAND2*NAME1A*
l
mundauchandereinselname
Hamburg | dgskorpus_hh_06 | 61+f   Also hearing people were surprised that deaf people could act like that.
rAND2AAFTERWARDS1A^*$GEST^*HEARING1A*SELF1A*
l
mundandererseitshörendselbst
Hamburg | dgskorpus_hh_08 | 46-60f   He talked to everyone from our old class and asked about their lives.
rAFTERWARDS1A^*ALL1A^TO-LIVE1A*
lQUESTION1*
mund auchfrageleben
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   Right now, I am training to become a construction draftswoman and I am an apprentice.
rAFTERWARDS1A^*EDUCATION1*UNTIL-NOW1NAÏVE1^
l
mausbildungbis jetzt
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   I’m old already, but the young people have to continue fighting. They have to build things up.
r$INDEX2*$ORAL^SELF1A*AFTERWARDS1A^*ACTIVE2^ACTIVE1^*TO-PROMOTE1A^
l
mwirmüssenselbstweiterkämpfen kämpfen[MG]aufbauen
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   I continued going there for many years.
rAFTERWARDS1A^*I1
l
m[MG]
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   That's why I switched to the club in Bonn.
rAFTERWARDS1A^*BONN2*TO2^*
l
mnachbonn
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   Another day we were thinking about going on a trip.
rAFTERWARDS1A^*DAY1A$GEST-TO-PONDER1^TO-PONDER1
l
manderetag[MG]überlegen
Köln (Cologne) | dgskorpus_koe_17 | 61+f   Shortly after/
rAFTERWARDS1A^*
l
m[MG]
Köln (Cologne) | dgskorpus_koe_17 | 61+f   It was before, shortly after the war started.
rBEFORE1B$ORAL^CLASH1^*AFTERWARDS1A^*CLASH1^*$GEST^
l
mvordemkriegbaldkrieg
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   Yes, the youth was very active in Munich.
rAFTERWARDS1A^*MUNICH1ADOWN1^MORE1*
l
mmünchenmehr
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   After that they had organized an evening program in the context of the Youth Festival. Evening program - do you say that?
rAFTERWARDS1A^*$GEST-NM^EVENING2PROGRAM1A
l
m[MG]abendprogramm
Leipzig | dgskorpus_lei_03 | 18-30m   Yes, I’d rather do it quickly there than doing it here every week.
rFAST3A$INDEX1TO-GET1A^AFTERWARDS1A^*
l
mschnellals
Leipzig | dgskorpus_lei_05 | 61+f   The man said, “Take them, I don't even want any money”.
rAFTERWARDS1A^*HE-SHE-IT2*ATTENTION1A^*TO-LET1^*
l
mihr mann[MG]
Leipzig | dgskorpus_lei_05 | 61+f   I didn't know what to do and I was embarrassed.
rI1AFTERWARDS1A^*DARN1*
lSHAME5I2*
mverdammtschämen
Leipzig | dgskorpus_lei_13 | 46-60m   The week before, I had been to a training course for referees with a group of deaf people.
rBEFOREHAND4*$GEST^*STILL1A*AFTERWARDS1A^*STILL1A*WEEK1B*BEFOREHAND4*
l
mvorher[LM:ähm]nochnocheine wochevorher
Leipzig | dgskorpus_lei_13 | 46-60m   The people were still protesting.
rTO-SHOW-FIST1^*AFTERWARDS1A^*
l
mdemo demo demo
Leipzig | dgskorpus_lei_15 | 18-30f   I was supposed to be back in school in Berlin the following Monday.
rAFTERWARDS1A^*I1*AFTERWARDS1A^*MONDAY10
l
michnächstenmontag
Leipzig | dgskorpus_lei_15 | 18-30f   I was supposed to be back in school in Berlin the following Monday.
rAFTERWARDS1A^*I1*AFTERWARDS1A^*MONDAY10SCHOOL1AI1
l
michnächstenmontagschule
Leipzig | dgskorpus_lei_15 | 18-30f   I was supposed to go to school the next day.
rI1$GEST^AFTERWARDS1A^*DAY1ASCHOOL1A$GEST^
l
mnächstentagschule
Münster | dgskorpus_mst_01 | 46-60m   If times get more and more stressful/
rSTRESS1A*I1I1AFTERWARDS1A^*
l
mstressich[MG]
Münster | dgskorpus_mst_10 | 46-60f   The Flood has already been here once, some time will pass, the water will retreat until there is another Flood.
rAND-THEN2*PROCEEDING1^*$INDEX1*AFTERWARDS1A^*ONCE-MORE1B*BACK1A*ONCE-MORE1B*
l
mund dann[MG]kommtwiederzurückwieder
Münster | dgskorpus_mst_11 | 61+m   There was a huge bunker with various floors directly next to the school.
rAFTERWARDS1A^*BIG3CBUNKER1*FLOOR1*
l
m[MG]großbunker[MG]
Münster | dgskorpus_mst_16 | 61+m   I went to school the next day.
rAND-THEN2*AFTERWARDS1A^*SCHOOL1C*
l
mdannmorgenschule
München (Munich) | dgskorpus_mue_01 | 61+f   Mrs #Name7 is organizing that.
rTO-CUT2D^*WOMAN2C$NAMEAFTERWARDS1A^*AREA1A^*TO-SHAKE-HANDS3^*
l
mffrau#name7[MG]
München (Munich) | dgskorpus_mue_03 | 46-60m   Eva Rossmeisl is the first chairperson of the choir “Singende Hände” and I am second chairman.
rAFTERWARDS1A^*$ALPHA1:E$NAME$ALPHA1:R
l
m[MG]evarossmeissl
München (Munich) | dgskorpus_mue_06 | 18-30f   Integrative day cares are good for young children, as well, so they can stay near their parents.
rALMOST2^PARENTS1ACLOSE-BY1B*
lIF-OR-WHEN1A*SMALL3AFTERWARDS1A^*PRESENT-OR-HERE1
mwenn[MG][MG]damitelternnäheda
München (Munich) | dgskorpus_mue_09 | 61+f   Then there is the emotional type.
rAFTERWARDS1A^*FEELING3HUMAN2$GEST^
l
mgefühlmensch
München (Munich) | dgskorpus_mue_11 | 31-45f   It was built overnight.
rTODAY2*AFTERWARDS1A^*TOMORROW1B*
l
mheutemorgen
München (Munich) | dgskorpus_mue_11 | 31-45f   But because my aunt received our mail and then continued to send it to him within the GDR, it wasn’t controlled.
rDIRECTION3*$GEST-OFF^*AFTERWARDS1A^*$INDEX1GDR4TO-SEND-OR-TO-DISPATCH2*
l$INDEX1
m[MG][MG]d-d-rschicken
München (Munich) | dgskorpus_mue_13 | 46-60m   When the teacher saw me putting down my stuff on a table, he asked me to sit in the front row.
rAFTERWARDS1A^*I1*FLEXIBLE4^*TEACHER2*
l
mlehrer
Rostock | dgskorpus_mvp_07 | 31-45f   We'll see what will happen.
rAFTERWARDS1A^*$GEST-OFF^
l
m[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   Later on, it was said that is was an assassination.
rAFTERWARDS1A^*TO-SAY1PENALTY1B^
l$INDEX-TO-SCREEN1
mspätersagtattentat
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   My cousin lives there; she’s becoming a fully trained hotel clerk or something like that.
rAPPROXIMATELY1*$GEST-TO-PONDER1^COMMA1^AFTERWARDS1A^*$GEST^
l
mglaubschon
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   The next folk festival is soon, in the summer.
r$INDEX1*FOLK-FESTIVAL-$CANDIDATE-NUE38^
lAFTERWARDS1A^*$INDEX1*AFTERWARDS1A^*
m[MG][MG]volksfest
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   The next folk festival is soon, in the summer.
r$INDEX1*FOLK-FESTIVAL-$CANDIDATE-NUE38^FROM-TO1^*
lAFTERWARDS1A^*$INDEX1*AFTERWARDS1A^*SUMMER8B*
m[MG][MG]volksfestsommer
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   At the sessions there, I sometimes grabbed a cigarette and then it got more and more.
r$NUM-ONE-TO-TEN1A:1d*$PRODTO-SMOKE1A*MORE3
lAFTERWARDS1A^*
mein[MG][MG]
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   The students coming after us, it’s better for them.
rAFTERWARDS1A^*HOW-QUESTION-COMPARISON1*TO-SEE1^ALWAYS4A*
l
m[MG]wieimmer
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   I hoped that in Taiwan/
rI1TO-HOPE3*AFTERWARDS1A^*I1*TAIPEI1^*$INDEX1
l
mhoffentaiwan
Schleswig-Holstein | dgskorpus_sh_01 | 18-30m   It wasn't like that at first, everyone was in a middling position, but then it just split and developed into different directions.
rMIDDLE2B*BETWEEN1B*SUDDENLY4*AFTERWARDS1A^*DIVISION1A^*$GEST-OFF^
l
mmitte??[MG]
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   They still pretend nothing has happened.
r$ORAL^$GEST^
lNEVERTHELESS4AFTERWARDS1A^*
mabertrotzdem[MG]
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   It was his last chance.
r$INDEX4$NUM-ONE-TO-TEN1A:1d*AFTERWARDS1A^*LAST1ACHANCE1*
l
meinletztechance
Schleswig-Holstein | dgskorpus_sh_06 | 31-45f   It’s supposed to be happening again soon, but I haven't heard anything yet.
rAFTERWARDS1A^*SHALL1$GEST^TO-LEARN-STH1A*
l
m[MG]soll
Stuttgart | dgskorpus_stu_03 | 31-45m   Maybe it will come to me in the near future. I don't know.
rNOW1$GEST-OFF^AFTERWARDS1A^*$GEST-OFF^NEXT1*TIME1
l
mje{tzt}vielleichtkommtnächsterzeit
Stuttgart | dgskorpus_stu_03 | 31-45m   Maybe it will come spontaneously, who knows.
rBUT1*AFTERWARDS1A^*$GEST-I-DONT-KNOW1^I1TO-KNOW-OR-KNOWLEDGE2A
l
maberkommtweißichweiß
Stuttgart | dgskorpus_stu_06 | 18-30f   Why didn’t they tell me themselves?
rWHY1*NOT3AAFTERWARDS1A^*TO-LET-KNOW1A*
l
mwarum
Stuttgart | dgskorpus_stu_14 | 46-60m   At 6:30 p.m. sharp we had to go inside, at 7 p.m. dinner was served, and at 8 p.m. sharp we had to go to bed.
rAFTERWARDS1A^*HALF1A$NUM-ONE-TO-TEN1A:7dUNTIL1*
l
mhalbsieben
Stuttgart | dgskorpus_stu_16 | 31-45f   If you were to calculate the inflation into it, it would probably already cost like ten Mark.
rAPPROXIMATELY2^NOW3*
lAFTERWARDS1A^*IN-ADDITION1
m[MG]jetzt
Stuttgart | dgskorpus_stu_16 | 31-45f   That sounds appealing in the beginning, but if you think about their future, you will see that they won't receive any pension; that is nothing to be taken lightly.
rBUT1*TO-KNOW-OR-KNOWLEDGE2B^ON-OR-AT1AFTERWARDS1A^*FUTURE1APENSION1$GEST-OFF^
l
maberanzukunftrente
Stuttgart | dgskorpus_stu_16 | 31-45f   Therefore, he continued working on the side.
rNEXT-TO1B*JOB1A*TO-BELONG1^*AFTERWARDS1A^*BEEN1^
l
mnebenjob
Stuttgart | dgskorpus_stu_17 | 31-45f   I watched Germany's soccer matches in-between, but I don't remember whom they played against.
rBETWEEN3*WHAT1A*TO-NEED1^*AFTERWARDS1A^*TO-WATCH1*FOOTBALL1A$INDEX1
l
m{zwi}schwasbesondersfußballspiel
Stuttgart | dgskorpus_stu_17 | 31-45f   Anyways, the deaf people there actively used the sign ROME [as CHAOS].
r$GEST-DECLINE1^AFTERWARDS1A^*I1UNDER1A^*AND5
l
megalu{nd}
= AFTER2A
Frankfurt | dgskorpus_fra_10 | 61+f   We started in Los Angeles, then we first drove towards the northeast and then continued to the southeast, to Arizona.
rAFTER2A$CUED-SPEECH*CROSS1A^*
lTO-BE-ON-THE-MOVE1
mlos angelesnacharizona arizona
Frankfurt | dgskorpus_fra_10 | 61+f   We drove to Athens by bus.
rBUS2TO-BE-ON-THE-MOVE1AFTER2A
l
mbus[MG]nach athen athen
Frankfurt | dgskorpus_fra_10 | 61+f   First to Istanbul, then onwards to (()), Korfu, (()) and then back home.
rTO-PARK1^TO-PARK1^TO-PARK1^
lAFTER2A
mnachistanbul??korfu
Frankfurt | dgskorpus_fra_12 | 61+m   I heard that the train was going to Frankfurt Main.
rI1TO-HEAR2*TRAIN2AAFTER2AFRANKFURT1*AFTERWARDS1A^SASH1B^
l
mzugnachfrankfurt am main
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   There are supposed to be some new rules next year. Did you hear about it?
rTO-SAY2AAFTER2ANEW4A$GEST-TO-PONDER1^RULE1A
l
m[MG]nächstes jahrneu
Leipzig | dgskorpus_lei_02 | 61+f   Later on, we got married.
rAFTER2ALATER10*TO-MARRY6PROCEEDING1^
l
mdannspäterheiraten
Leipzig | dgskorpus_lei_02 | 61+f   One was in a street called Maistraße, one in a street called Hohe Straße, and another was in a street called Eisenacher Straße.
rSTREET1*$INDEX1*SHELF2C^*
lAFTER2A
meisenacher straße
Leipzig | dgskorpus_lei_13 | 46-60m   The nursery school educators knew that a lot of people went to the West Germany to do some shopping and that they all would come back the next day.
rTO-KNOW-OR-KNOWLEDGE2BALL2AFLIGHT1B*AFTER2ATO-SHOP1*BACK1A*TO-KNOW-OR-KNOWLEDGE2B
l
mweißalle[MG]nacheinkaufzurückwissen
München (Munich) | dgskorpus_mue_07 | 18-30m   Dealing with deaf people in the USA, for example, is totally normal.
rCLEAR1A*I2AMERICA1*AFTER2A$GEST-OFF^QUOTATION-MARKS1*OF-COURSE1B*
l
m[MG][MG]nachselbstverständlich
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I spent the last weekend in Copenhagen.
rA-MOMENT-AGO2*WEEKEND3*COPENHAGEN2*AFTER2AI1
l
m[MG]wochenendekopenhagen
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I flew there on Friday for the very first time.
r$GEST-TO-PONDER1^FRIDAY5*AFTER2AFIRST-TIME3A*AIRPLANE2A*I1
l
mfreitagnachersten malflugzeug
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   We traveled abroad.
rAFTER2AABROAD1TO-DRIVE1*$GEST-OFF^*
l
m[MG]ausland[MG]
Stuttgart | dgskorpus_stu_04 | 61+f   When they came to the west part of Germany, they were finally able to eat bananas and oranges.
rAFTER2AAFTER2AREADY2A^BANANA6
l
mnach westennach westenendlichbanane
Stuttgart | dgskorpus_stu_04 | 61+f   When they came to the west part of Germany, they were finally able to eat bananas and oranges.
rAFTER2AAFTER2AREADY2A^BANANA6ORANGE6*
l
mnach westennach westenendlichbananeorange
Stuttgart | dgskorpus_stu_05 | 61+m   Do you also sometimes feel like going to Singen?
rYOU1SOMETIMES3*NECK1^AFTER2ATO-SING3BNEVER1*
l
mdumanchmalnachsingenniemals
Stuttgart | dgskorpus_stu_06 | 18-30f   If we’re going to Namibia soon, what should we do there, what options do we have?
rTO-THINK1ATOGETHER3A*AFTER2A$ALPHA1:N$INDEX1WHAT-ARE-YOU-DOING1*
l
mnamibiawas macht
Frankfurt | dgskorpus_fra_10 | 61+f   On the way back we drove along the coast to Los Angeles.
rTO-BE-ON-THE-MOVE1DIRECTION3^*TO-BE-ON-THE-MOVE1AFTER2A*$ORAL^
l
m[MG]nachmeer entlangnachlos angeles
Frankfurt | dgskorpus_fra_10 | 61+f   We took a plane to Sofia.
rAIRPLANE1*AFTER2A*
l
mflugnach sofia
Göttingen | dgskorpus_goe_04 | 31-45m   We hopped on the bus and drove to the party.
rBUS1AI1TO-GET-IN1*TO-CELEBRATE1
lAFTER2A*
mbusichnachfeier
Göttingen | dgskorpus_goe_04 | 31-45m   It was handed over to Bulgaria, to Sofia.
rFLAG1A*$INDEX1TO-GIVE1A^*AFTER2A*BULGARIA4*BULGARIA4*$ALPHA1:S
l
müberreichennachbulgariensofia
Bremen | dgskorpus_hb_05 | 61+f   He said, “If your child were to go to America and came back, it would have to go to a neurology clinic.”
rIF-OR-WHEN1ACHILD1AFTER2A*AMERICA1BACK1A*$INDEX1
l
mwennkindnachamerikazurück
Hamburg | dgskorpus_hh_05 | 31-45m   We stayed on Phuket for two or three days, then got on a ship and went to Phi Phi.
rTO-SWARM1^*THEN1ASHIP1AFTER2A*ARROW4^*
l
m[MG]dannschiffnachphi {phi}
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   So, if we place third at the North Rhine-Westphalian championship, we won’t be able to play in the German championship next season.
rWE2*TO-LIST1C*$NUM-ORDINAL1:3d*AFTER2A*$ALPHA1:S*I1*INVOLVED1A*
l
mzweitedrittenächstesaisonni{cht} dabei
Leipzig | dgskorpus_lei_12 | 61+m   For example, we would have loved to use sign language with each other during our leisure time in the afternoon.
rEXAMPLE1*YOU-PLURAL1AAFTER2A*LUNCH-OR-NOON1FREE1*TIME5A*
l
mbeispieln{ach}mitt{ag}freizeit
München (Munich) | dgskorpus_mue_01 | 61+f   I once went on a trip to Thuringia.
rWAS1TRIP4*AFTER2A*TO-NEED2^$CUED-SPEECH*$INDEX1
l
mwarausflugnachthüringen
München (Munich) | dgskorpus_mue_03 | 46-60m   Some others from Augsburg drove to Rome by bus.
rAUGSBURG1A*WITH1A*BUS1A*AFTER2A*ROME1*
l
maugsburgmit dembusnachrom
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   She was nominated and invited to Lübeck.
rNOMINATION1*TO-INVITE1A*AFTER2A*END4^
l
mnominierteingeladennach nürnbergzu ende
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I wished them a wonderful flight back to America.
rIF-OR-WHEN1ABEAUTIFUL1A*AIRPLANE2C*AFTER2A*AMERICA1*GOOD1*
l
m[MG]schönenflugnachamerika
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   In the Kiel Fjord, you can go from Kiel to Laboe by boat, it’s beautiful.
r$INDEX1KIEL1*$PRODAFTER2A*$PRODBEAUTIFUL1A*SHIP1
l$PROD
mkielnachlaboeschiff
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   And there’s a small passage to Sweden by boat.
rLINK1SHIP1AFTER2A*SWEDEN1*TO-DRIVE3*
l
m{ver}bindungschiffnachschweden[MG]
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   We went to Berlin.
rI1AFTER2A*BERLIN1A*
l
mnachberlin
Stuttgart | dgskorpus_stu_06 | 18-30f   The only free weekend would be a week before Christmas.
r$NUM-WEEK-AFTER-NOW1:1d*$INDEX1*CHRISTMAS4A*AFTER2A*BEFORE1B*
l
meine wocheweihnachten
= AND-THEN1
Berlin | dgskorpus_ber_04 | 46-60m   But I'm still active in the sport's sector.
rAND-THEN2AND-THEN1I1NOW1*STILL5*
l
mund dannjetztnoch
Berlin | dgskorpus_ber_05 | 61+f   To actually talk, I would’ve needed an interpreter, but getting one would’ve taken too long, so we communicated in writing.
rI1*ANSWER1*LIKE-THIS4*AND-THEN1$GEST-OFF^SHE1*$PROD
l
mso sound
Berlin | dgskorpus_ber_07 | 31-45m   I can’t recall exactly how long the show was but the way it was structured, beginning to end and the little breaks in between were just right.
rBEGINNING1A*PERIOD1A*PAUSE1AND-THEN1OUTDOORS1A^MEASURE-SCALE1DONE4
l
manf{ang}pauseund dannmaß[MG]
Berlin | dgskorpus_ber_08 | 46-60f   From September 1st onwards, I am unemployed once again.
rSEPTEMBER2A
lAND-THEN1OFF1AFIRST-OF-ALL1C
mdannabersteseptember
Frankfurt | dgskorpus_fra_09 | 31-45m   In Ludwigshafen, for example, you basically just need to snap your finger, and you'll get an interpreter right away.
rI1ALMOST2^IT-WORKS-OUT1AND-THEN1ALMOST2^*IT-WORKS-OUT1
l
mklapptklappt
Frankfurt | dgskorpus_fra_14 | 31-45f   And about two years ago it's like you vanished.
rAND-THEN1$NUM-YEAR-BEFORE-NOW1:2dVANISHED1AWHAT1B^
l
mund dannzwei jahre[MG]
Frankfurt | dgskorpus_fra_14 | 31-45f   The course was from spring until summer and from fall until winter, ten times each interval.
rSUMMER2MEASURE2B^SEGMENT2AAND-THEN1AUTUMN3WINTER1MEASURE2B^*
l
msommerherbstwinter
Göttingen | dgskorpus_goe_01 | 61+m   Thanks to doping everyone wants to become better and faster, and what is the good of that?
rPERFORMANCE5SPORTS4B*PERFORMANCE5AND-THEN1$GEST^AND-THEN1THANKS1^*
l
mleistungsportund dannund dann[MG]
Göttingen | dgskorpus_goe_01 | 61+m   Thanks to doping everyone wants to become better and faster, and what is the good of that?
rPERFORMANCE5AND-THEN1$GEST^AND-THEN1THANKS1^*AND-THEN1
l
mund dannund dann[MG]und dann
Göttingen | dgskorpus_goe_01 | 61+m   Thanks to doping everyone wants to become better and faster, and what is the good of that?
r$GEST^AND-THEN1THANKS1^*AND-THEN1
l
mund dann[MG]und dann
Göttingen | dgskorpus_goe_09 | 61+f   I could have continued that career, but I just couldn’t find a new job in Salzgitter.
rTHEN1CAND-THEN1CAN1I2FURTHER1B
l
mund dannkannweiter
Bremen | dgskorpus_hb_03 | 31-45f   One has to educate them and present arguments, for example the case of a broken CI, how one can handle that situation, etc.
r$LIST1:3of3dIF-OR-WHEN1ABROKEN4AND-THEN1WHAT-DOES-IT-LOOK-LIKE1ARGUMENT1*
l
mwennkaputtund dannwie sieht aus
Bremen | dgskorpus_hb_03 | 31-45f   Therefore they start to try a CI.
rAND-THEN1SOLUTION2TO-TRY1CI1
l
mund dannlosversuchenc-i
Bremen | dgskorpus_hb_04 | 18-30f   It seems like death is bound to happen.
r$GEST^CALCULATOR1^*
lEVEN1DEATH3AND-THEN1ON-PERSON1*
msogartodundvorprogrammiert
Hamburg | dgskorpus_hh_01 | 61+m   We put the pasta in the bowl. After that, we poured the mayonnaise on top, and mixed everything well.
rTO-MIX3AND-THEN1NOODLES5*ON1A^*TO-MIX3
lTO-POUR-OR-TO-WATER1A^TO-POUR-OR-TO-WATER2^
mremouladenudeln[MG]
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   When we travelled by Intercity Express from Dortmund to Cologne to go to school, we communicated in DGS, too.
rSCHOOL1A$ALPHA1:I-C-EBACK-AND-FORTH1*AND-THEN1UNTIL1COLOGNE3*TO2*
l
mschulei-c-eund dannbisköln
Köln (Cologne) | dgskorpus_koe_13 | 61+m   The youth coach once organized a trip on a Saturday.
rAPPOINTMENT1A
lAND-THEN1YOUNG2TO-GUIDE1B
mund dannjugendleitertermin
Köln (Cologne) | dgskorpus_koe_14 | 61+f   Then the eldest turned 18 and was in a relationship.
rAND-THEN1$INDEX1TALL5B*$NUM-TEEN1:8d
l
mund danngroßachtzehn
Köln (Cologne) | dgskorpus_koe_14 | 61+f   Then my mother/
rAND-THEN1$INDEX1MOTHER1*$GEST^
l
mund dannmutter
Köln (Cologne) | dgskorpus_koe_14 | 61+f   And then she got to the school in Dortmund and I wasn't sure if everything would work out.
rAND-THEN1TO-MOVE2*I1TO-BELIEVE2B*
l
mund danndortmundich
Köln (Cologne) | dgskorpus_koe_14 | 61+f   Later in Hagen then/
rAND-THEN1LATER10TO-LIFT-CRANE1^*$INDEX1
l
mund dannspäterhagener
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   There are bumper cars and shooting games.
rCAR1*$PROD$GEST^AND-THEN1TO-PLAY2*TO-SHOOT1B^*$PROD
l
mauto[MG]undspiel[MG]
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   With the relay team I was able to win a medal.
rAND-THEN1RELAY4*I1TO-ACCOMPLISH1C
l
mdannstaffelschaffen
Leipzig | dgskorpus_lei_07 | 46-60f   It was more about sentences there.
rSENTENCE2*
lAND-THEN1MORE1
mund dannmehrsatz satz
Leipzig | dgskorpus_lei_09 | 31-45f   How was I supposed to get back home - it was far away.
r$GEST^
lI1*AND-THEN1I1FAR-FAR-AWAY1
mund dannwie
Münster | dgskorpus_mst_06 | 31-45m   And the farewell celebration, wow, we were sat at a table and were served twelve different dishes.
rAND2A*AND-THEN1FLAP1A^*$INDEX1*A-WHOLE-LOT2
l
mab{schluss}[MG]
Münster | dgskorpus_mst_10 | 46-60f   And then/
rAND-THEN1
l
mdann
Münster | dgskorpus_mst_13 | 46-60f   I knew the story, because I had read it.
rI1*AND-THEN1I1*TO-KNOW-STH-OR-SB1AHISTORY-OR-STORY2*
l
mund dann
Münster | dgskorpus_mst_13 | 46-60f   Afterwards I was retrained.
rAND-THEN1I1RETRAINING1*
l
mund dannumschulung
München (Munich) | dgskorpus_mue_12 | 46-60f   Together, father and son walk into the dining room, where a table is set with cups and saucers.
rAND-THEN1$INDEX1$PROD$INDEX1
l
mund dann
Rostock | dgskorpus_mvp_02 | 31-45m   One can also roll it out and then put it in the tin.
rOR4ATO-ROLL-DOUGH1AND-THEN1$PROD$PROD
l
moderrollenund dann[MG][MG] form
Rostock | dgskorpus_mvp_02 | 31-45m   Once the cake is prepared, you can put it into the oven.
r$PRODIN-ADDITION1*DONE2*AND-THEN1$PRODDONE2*
l
malles [MG] dazuallesfer{tig}rein[MG]
Rostock | dgskorpus_mvp_02 | 31-45m   Then one has to put a baking sheet on top, that’s how I always do it.
rAND-THEN1PAPER1*TO-BAKE3A*TO-BAKE3A*
l
mund dannpap{ier}backpapier
Rostock | dgskorpus_mvp_02 | 31-45m   Once the 15 minutes are over, one can check again.
rAND-THEN1DONE2*$NUM-TEEN1:5*MINUTE2*
l
mund dannfertigfünfzehnminute
Rostock | dgskorpus_mvp_08 | 46-60m   Then those winners left and the shot putters came, the javelin throwers, one after the other.
rASIDE1BSHOT-PUT1TO-GIVE2AND-THEN1ASIDE1BSPEAR1ASIDE1B
l
mkugelspeer
Stuttgart | dgskorpus_stu_13 | 31-45f   They get into the topic to be able to talk about it until they get tested.
rSUBJECT1TO-FOCUS1A^TO-TELL4AND-THEN1TO-EXAMINE1$NUM-NUMBER-OF-PEOPLE1:3dTOGETHER3A*
l
mthemadannprüfungdreizusammen
Stuttgart | dgskorpus_stu_13 | 31-45f   As a result, one person does all the work while the two others lean back and relax, but all of them get the same grade.
r$LIST1:3of3dTO-SIT1A*$GEST^AND-THEN1GRADE3TO-GIVE1*
l
mund dannnote
Stuttgart | dgskorpus_stu_13 | 31-45f   What are you supposed to do if you're out of luck and have to work with someone who's lazy?
rTO-LET2A^*TO-SIT1A^*$GEST^AND-THEN1
l
mfaulund dann
Stuttgart | dgskorpus_stu_13 | 31-45f   When I ask my children about those old stories they don't know a thing about it.
rAND-THEN1I1CHILD2QUESTION1
l
mund dannkinderfragen
Stuttgart | dgskorpus_stu_13 | 31-45f   So I was just drawing and then he asked me what kind of job career I had in mind.
rTO-AFFECT1*I1TO-PAINT5*AND-THEN1PROFESSION4WHAT1B*PROFESSION4
l
m[MG][MG]und dannberufwasberuf
Stuttgart | dgskorpus_stu_13 | 31-45f   “The photons collide and then …“ - I missed everything.
rMATERIAL1C^*PHYSICS1$INDEX1*AND-THEN1TO-MISS-STH1
l
mphotonen[MG]und dannvorbei
Stuttgart | dgskorpus_stu_13 | 31-45f   When they decided on my grades for my report card I was advised to take an oral exam.
rAND-THEN1I1DOCUMENT-OR-CERTIFICATE3*GRADE3
l
mund dannzeugnisnote
Stuttgart | dgskorpus_stu_13 | 31-45f   So what did I do this for?
rAND-THEN1FOR-WHAT1*
l
mund dannwofür
Stuttgart | dgskorpus_stu_16 | 31-45f   And if I run out of money, where would I get if from?
rAND-THEN1$GEST-OFF^*I2*HELPLESS2*
l
mund dann[MG]
Berlin | dgskorpus_ber_08 | 46-60f   And what happened then?
rAND-THEN1*$GEST-OFF^*
l
mund dann
Frankfurt | dgskorpus_fra_09 | 31-45m   The money will be split among the master and the apprentice.
rAND-THEN1*TO-PAY3*BUT1SALARY1
l
mabergehalt
Frankfurt | dgskorpus_fra_14 | 31-45f   The next week, the fourth week, will be at the end of February.
rAND-THEN1*END1AFEBRUARY13$NUM-ORDINAL1:4
l
mund dannendefebruarvierte
Frankfurt | dgskorpus_fra_14 | 31-45f   After that there will be build-up modules.
rAND-THEN1*UPDATE1B^GROUP1B^*AHEAD1B^
l
mdannaufbaumodulevor
Göttingen | dgskorpus_goe_06 | 31-45f   It was her death sentence.
rAND-THEN1*DEATH2*TRUE3*$GEST-OFF^
l
mtodwahr
Göttingen | dgskorpus_goe_09 | 61+f   That’s the way it continues until you can see the first small plants, which need to be handled very carefully.
rAND-THEN1*UNTIL1*SMALL9TO-GROW1A*
l
mbis[MG][MG]
Bremen | dgskorpus_hb_02 | 46-60f   And then it’s Christmas Day.
rAND-THEN1*$NUM-ORDINAL1:1CHRISTMAS4A*DONE3A
l
mund dannerstweihnachts{tag}
Bremen | dgskorpus_hb_04 | 18-30f   Did his assassination happen during his first or second period in office?
rALREADY1B$NUM-ORDINAL1:2ELECTION1AAND-THEN1*DEATH2*
l
mschonzweites mal wahlund dann[MG]
Bremen | dgskorpus_hb_04 | 18-30f   This is portrayed in many movies, where one person is hired to kill another one, but that hit man hires another on and so on and so forth to the actual murderer.
rLIKE4A*AND-THEN1*THERE-IS3*TO-KNOW-STH-OR-SB1A*MOVIE1
l
moderund danngibtspielfilm
Bremen | dgskorpus_hb_04 | 18-30f   This is portrayed in many movies, where one person is hired to kill another one, but that hit man hires another on and so on and so forth to the actual murderer.
rTO-KNOW-STH-OR-SB1A*MOVIE1SOMETIMES2*AND-THEN1*TO-LET-KNOW1ATHEN1ATO-LET-KNOW1A
l
mspielfilmmanchmalund[MG]dann
Hamburg | dgskorpus_hh_02 | 31-45f   I know that there are many interpreters available, people can go to university, so I’m wondering: why implant children?
rPRESENT-OR-HERE1*TO-STUDY1PRESENT-OR-HERE1*AND-THEN1*CI1*
lWHY1*
mstudiumda da da daund dannwarum
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   After the fall of the Berlin Wall all the politicians went to West Germany and left their houses vacant.
rFALL-OF-THE-BERLIN-WALL1AND-THEN1*GOOD1*$INDEX1SELF1A*
l
m[MG]
Köln (Cologne) | dgskorpus_koe_14 | 61+f   And ten years later, another child was born.
rBUT1^AND-THEN1*YEAR1B*LATER10*AFTER1*
l
mund dannzehn jahrspäternachkömmling
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   I ran the hundred and two hundred meters during the Deaflympics.
rI1AND-THEN1*I1MATCH1*SOMETIME1^*
l
mdannwettkampf
Münster | dgskorpus_mst_03 | 18-30f   But it’s a waste of money to travel five thousand, two thousand or seven thousand kilometers to then go back home after only about two weeks.
r$NUM-THOUSANDS1:3dDIFFERENCE1B^*AIRPLANE2B*AND-THEN1*WEEK1B*TO-SWARM1^AWAY1^*
l
mdreit{ausend}[MG]und dannzwei wochenzurück
Münster | dgskorpus_mst_11 | 61+m   I still knew him, too.
rTO-KNOW-STH-OR-SB1A*AND-THEN1*$LIST1:3of3d*$GEST-OFF^*
l
mkenn[MG]
Münster | dgskorpus_mst_16 | 61+m   The kid told my mom what our homework was and she wrote it down.
rTO-LET-KNOW1A*$INDEX1AND-THEN1*$INDEX1TO-LET-KNOW1A*TO-WRITE3^*
l
mhat infodannmamaaufschreiben
Rostock | dgskorpus_mvp_02 | 31-45m   Then one adds the eggs.
rAND-THEN1*EGG1A*IN-ADDITION1*
l
mund danneierdazu
Rostock | dgskorpus_mvp_02 | 31-45m   Then one can spread it out in a cake tin as the base.
rAND-THEN1*GROUND1BAKING-DISH2*AREA1D*
l
mund dannbodenform kuchenform[MG]
Rostock | dgskorpus_mvp_02 | 31-45m   One can take it from the oven and eat it.
r$PRODAND-THEN1*MUST1A^*TO-OPEN-COVER6*TO-EAT-OR-FOOD2
l
mkuchen herausnehmenund dannkannst duauf machen essen
Rostock | dgskorpus_mvp_06 | 61+m   And then/
rAND-THEN1*
l
mund dann
Rostock | dgskorpus_mvp_06 | 61+m   Then I worked at a private construction company for almost ten years, a construction company.
rAND-THEN1*$NUM-ONE-TO-TEN1A:9*ALMOST2SOON5*
l
mund dannfastbald
Schleswig-Holstein | dgskorpus_sh_03 | 46-60f   What did you do for last New Year's Eve? In 2010?
rAND-THEN1*MAGIC3^*LAST5YOU1
l
msilversterletztes jahr
Stuttgart | dgskorpus_stu_05 | 61+m   I often tell my mum that she should go to events for deaf people, but she only sits at home, knits and complains about others thinking she’s fake.
r$INDEX1SPIKY2B^*TO-KNIT2AAND-THEN1*TO-SAY1ALL2AON-PERSON1*
l
mzu hause[MG]dannsagenallefalsch
= LATER6
Berlin | dgskorpus_ber_03 | 46-60f   Later, we discussed the matter.
rLATER6TO-REPLACE1$INDEX1
l
mspäter[MG]
Berlin | dgskorpus_ber_05 | 61+f   I was so scandalized, so now, they have a big remark in their book that I, Mrs. Jauering, can’t wait. Big and fat and underlined in read.
rTO-FEEL-INDIGNANT1I1LATER6THEN1A*PHYSICIAN1*TO-LET-KNOW1A
l
m[MG]späterdann
Frankfurt | dgskorpus_fra_12 | 61+m   Later on, when Kennedy was shot dead, how did I hear about it?
rTHEN1C*LATER6$INDEX1TO-SHOOT1B$INDEX1
l
mdannspäterkennedyerschossen
Münster | dgskorpus_mst_04 | 31-45m   He then gives me something to eat or drink and I return it to him later on.
rTO-DRINK1*TO-EAT-OR-FOOD2TO-GIVE1*LATER6BACK2*
l
mtrinkessgebzurück
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   Later on — I think it was September 7th or 8th — I flew back to Germany and read about it.
rLATER6$INDEX1$NUM-ORDINAL1:7d$NUM-ORDINAL1:8d
l
mspäteramsiebterachter
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   Later, the Queen had to acknowledge that everyone loved Diana and that she was even more famous than her.
rTO-ADMIT1ALL1A*
lLATER6TO-BE-SILENT3^
mspäterzugeben[MG]alle
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   Later, the tabloids repeatedly published new stories about the incident but at some point it calmed down.
rLATER6ONCE-MORE1B*NEWSPAPER1AHOW-QUESTION1*
l
mspäterwiederzeitung
Stuttgart | dgskorpus_stu_05 | 61+m   Later I was also active in the church, as an altar boy.
rATTENTION1A^LATER6ATTENTION1A^LATER10RELIGION2B
l
mspäterreli{gion}
Stuttgart | dgskorpus_stu_05 | 61+m   Later I was also active in the church, as an altar boy.
rRELIGION2B$INDEX1OFTEN2BLATER6ALSO3ATO-SUFFER1A^*I1
l
mreli{gion}späterauchministrant
Stuttgart | dgskorpus_stu_15 | 61+f   One time, we read one of my books together.
rAND2ALATER6MY1BOOK1A$INDEX1
l
mund dann[MG][MG]buch
Stuttgart | dgskorpus_stu_15 | 61+f   Later on, I told the story to my younger sister-in-law. She said, ”Yes, she always does that.”
rLATER6TO-TELL1SMALL5*EQUAL1C^*
l
mspätererzählkleineschwägerin
Stuttgart | dgskorpus_stu_15 | 61+f   It‘s cruel to do it to infants; those babies have no say in it.
r$GEST-OFF^ALREADY1BCI1LATER6$PROD$GEST-OFF^
l
m[MG]schonspäterab[MG]
Berlin | dgskorpus_ber_10 | 31-45m   That came later, with another wife.
rYOU1LATER6*DIFFERENT2*$GEST-DECLINE1^*
l
mduspäterand{ere}
Göttingen | dgskorpus_goe_01 | 61+m   That's true.
rRIGHT-OR-AGREED1ALATER6*
l
mstimmtspäter
Göttingen | dgskorpus_goe_02 | 61+m   Maybe it makes sense to you now but when you're 70 or 80 years old, you'll get sick.
rSENSE1LATER6*$NUM-TENS1:7$NUM-TENS1:8dOLD2C
l
msinnsiebzigachtzigalt
Göttingen | dgskorpus_goe_03 | 61+f   It was like a curse, so many assassinations following that first one.
r$PRODLIKE4A*MAIN1A^LATER6*MAIN1A^$INDEX1*
l$INDEX1
mfluchwieeinspä{ter}wie[MG]
Göttingen | dgskorpus_goe_04 | 31-45m   She paid for it and told me to come back to her afterwards to pay her back.
rRENT2*EVERYTHING2*FOR1*LATER6*TO-MAKE-UP-FOR-STH1I1BACK1A*
l
mmietedafürnachholenzurück zurück zurück
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   His semen is brought to a laboratory and the woman is inseminated afterwards.
rLABORATORY2*IN-ADDITION1^*$GEST-DECLINE1^*LATER6*$INDEX1*$PROD
l
mlaborspäter
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   Therefore, each house was marked with a number, beginning with one.
rHOUSE1A*NUMBER2A*$NUM-ONE-TO-TEN1A:1d*LATER6*$PROD
l
mhausnummereinsspä{ter}[MG]
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   Well, I went there and there is/
rLATER6*I1$INDEX1HIGH2^*
l
mspäter
Leipzig | dgskorpus_lei_01 | 18-30m   The interpreter gains experience by interpreting again and again.
rSUDDENLY4^$INDEX1TO-COME1LATER6*TO-HIRE1A*HERE1EXPERIENCE-OR-KNOWLEDGE1B*
l
m[MG][MG]erfahrung
Leipzig | dgskorpus_lei_09 | 31-45f   They told me that if I didn’t have surgery, I wouldn’t be securely mobile on my own legs once I’m old.
rTO-TAKE1ANOT3A*
lNOT3ALATER6*OLD5A*WALKING-CANE1*$INDEX1
mnehmennichtalter
Münster | dgskorpus_mst_16 | 61+m   Later/ That's how it was.
rAND-THEN2*LATER6*$GEST-OFF^LIKE-THIS1A*
l
mdannspäterso
München (Munich) | dgskorpus_mue_10 | 31-45m   She woke up again, after I opened the door, although I had pressed down the handle very carefully.
rLATER6*OPEN-DOOR1*$GEST-OFF^
lAWAKE1*
mspäterwach
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   Maybe later, when the prince is dead, there will be a statement.
rMAYBE2*LATER6*$ALPHA2:W*PARTY-POLITICAL1^*$INDEX1*
l
mvielleicht[MG]wennprinz
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   Later on, I visited the site again and there were other dates listed.
rLATER6*TO-OPEN4$INDEX1DIFFERENT2
l
mspäteröffnenander
Stuttgart | dgskorpus_stu_01 | 46-60f   I looked at the flyer once more later on.
r$INDEX1LATER6*TO-SAY1^$INDEX1SQUARE2^*
l
mspäter
Stuttgart | dgskorpus_stu_11 | 46-60m   They only found out about that later on.
rLATER6*SELECTION1H*
l
mspäterherausgefunden
= NEXT1
Berlin | dgskorpus_ber_02 | 46-60m   I was supposed to go to Malmö in 1973 as well, but unfortunately I was injured.
rTHEN7NEXT1$NUM-ONE-TO-TEN1D:8d$NUM-TENS2A:7d*TO-GO-THERE1^*
l
mdanndreiundsiebzigmalmö
Berlin | dgskorpus_ber_02 | 46-60m   It‘s too much for this year, but I will do it next year, in 2012.
rBUT1$GEST-NM^MUCH-OR-MANY1ANEXT1YEAR1A$NUM-THOUSANDS1:2$NUM-TAPPING1:2
l
mzu vielnächstjahrzweitausendzwölf
Berlin | dgskorpus_ber_02 | 46-60m   I‘ll be leaving next Sunday.
rNEXT1SUNDAY1ADEPARTURE1*NEXT1
l
mnächsten wo{che}sonntagnächsten wo{che}
Berlin | dgskorpus_ber_02 | 46-60m   I‘ll be leaving next Sunday.
rNEXT1SUNDAY1ADEPARTURE1*NEXT1SUNDAY1ADEPARTURE1*
l
mnächsten wo{che}sonntagnächsten wo{che}sonntag
Berlin | dgskorpus_ber_04 | 46-60m   The following Deaflympics were held in Cologne in 1981.
rNEXT1$NUM-ONE-TO-TEN1A:1$NUM-TENS4A:8dIN1
l
meinundachtzigin
Berlin | dgskorpus_ber_04 | 46-60m   From now on there will be no water polo tournament at the Deaflympics anymore.
rOFF2PERIOD1C^TO-SAY1NEXT1DEAF-ASL1*CHAIN1^*OUTDOORS2^
l
mabnächstedeaflympics
Berlin | dgskorpus_ber_04 | 46-60m   We hoped to do the same in Melbourne.
rALL1A*TO-HOPE3NEXT1TO-PLACE1MELBOURNE1*TO-TRY1
l
m[MG][MG]nachmelbourneversuchen
Berlin | dgskorpus_ber_04 | 46-60m   I'll also organize the German Deaf Sports Days 2012 in Berlin.
rALSO3A*TO-ORGANISE2AFOR1NEXT1GERMAN1DEAF1ASPORTS1*
l
mauchorganisierenfürnächste jahrdeutsch gehörlos sportfest
Berlin | dgskorpus_ber_04 | 46-60m   The next Deaf Sports Festival will take place here in Berlin.
r$GEST-OFF^NEXT1SPORTS1*WHAT1AIN1
l
mundnächstesportwasin
Berlin | dgskorpus_ber_04 | 46-60m   I have already booked 95% of the sports arenas.
r$GEST^NEXT1I1ALREADY1BTOGETHER2C*
l
malsonächsteschonzusammen
Berlin | dgskorpus_ber_04 | 46-60m   I think the next Deaf Sports Festival will have many positive aspects.
rI1TO-THINK1BNEXT1MORE1*POSITIVE1*SERVICE-OR-DUTY7^*
l
mdenkenächste malmehrpositivbringen
Berlin | dgskorpus_ber_04 | 46-60m   I'm often away with my kids, then we go visit different family members. We always take turns visiting each other.
rOUTDOORS1A^*SAME5DIFFERENT6*NEXT1WHAT1B*TO-CHANGE2C^*AMONG-EACH-OTHER3*
l
mmalselbeanderswas machenanders
Berlin | dgskorpus_ber_04 | 46-60m   I recommend you to go to the next Cultural Days in Erfurt in September.
rTO-RECOMMEND1ATO-RECOMMEND1ANEXT1CULTURE1B*DAY1AIN1
l
mempfehlenempfehlennächstekulturtagin
Berlin | dgskorpus_ber_04 | 46-60m   I work together with my work assistant. She attends meetings with me and interprets there for me, for instance.
rTO-COME2*TOGETHER-PERSON1TOGETHER-PERSON1^*NEXT1TO-DISCUSS1ALL2D*INTERPRETER1*
l
mbesprechungdolmetscher
Berlin | dgskorpus_ber_04 | 46-60m   Sometimes, when it is all too much for me, I give the kids to their grandma.
rALSO3ANEXT1WHAT1A*GOOD1^*TO-INCREASE-OR-TO-GAIN-WEIGHT3^*
l
mauchnächste malwaszu viel
Berlin | dgskorpus_ber_04 | 46-60m   You can be there next September in Erfurt.
rYOU1*NEXT1SEPTEMBER7AERFURT1*$GEST^
l
mnächstseptembererfurt
Berlin | dgskorpus_ber_06 | 31-45m   If I lost the card game, I had to give my fine meat to my opponent the upcoming Sunday.
rTO-LOSE5FOR1DAY1A*NEXT1IF-OR-WHEN1ASUNDAY1C$NUM-ONE-TO-TEN1A:1d
l
mfürnächstesonntagein
Berlin | dgskorpus_ber_07 | 31-45m   Hopefully there will be a fifth festival next year.
rTO-HOPE2BNEXT1YEAR2B$NUM-ORDINAL1:5*$GEST-OFF^*
l
mhoffennächstjahrfünfte
Berlin | dgskorpus_ber_07 | 31-45m   I’ll be there next year so there will be 61 visitors.
rNEXT1OVER-OR-ABOUT1*$NUM-ONE-TO-TEN1A:1$NUM-TENS2A:6d*
l
mnächst{es mal}übereinundsechzig
Berlin | dgskorpus_ber_07 | 31-45m   One should tell them that they don’t have to come in the first place then.
r$PRODTO-LET1ANYWAY2*NEXT1TO-COME1TO-NEED1*
l
msowiesonächstekommenbrauch nicht
Berlin | dgskorpus_ber_08 | 46-60f   But this time, he didn't want to go, he wasn't feeling well that week. But he wanted to do so the week after.
r$GEST-DECLINE1^*$INDEX1$GEST-TO-PONDER2^NEXT1TODAY1*MOMENT1*BODY1^*
l
m[MG][MG]nächsten m{al}heutemom{ent}[MG]
Berlin | dgskorpus_ber_08 | 46-60f   But not long after that he passed away, I was completely shocked.
rI1SHOCK2B*
lNEXT1TO-DIE2
mschock
Frankfurt | dgskorpus_fra_04 | 61+m   You can come to the next one.
rCELEBRATION1ATO-COME1$INDEX1*
lNEXT1
mnächstesfest
Frankfurt | dgskorpus_fra_05 | 46-60m   He will be here next summer, you can arrange something with him then.
rNEXT1SUMMER2TO-COME1TALK1*
l
mimsommer[MG]
Frankfurt | dgskorpus_fra_06 | 31-45f   The next morning I met my three deaf colleagues from work.
r$GEST-DECLINE1^*$GEST-TO-PONDER1^THEN1ANEXT1MONDAY13ATHEN1ATO-WORK2*
l
mnächstmontagdannarbeit
Frankfurt | dgskorpus_fra_06 | 31-45f   My mother introduced me to him and asked if I could go to school already.
r$INDEX1*TO-LET-KNOW1ATO-INTRODUCE1*NEXT1SCHOOL1CTO-HIRE1A*$GEST-OFF^
l
mnächstschule
Frankfurt | dgskorpus_fra_11 | 18-30m   Next year, in 2012, there is supposed to be another parade.
rNEXT1$NUM-THOUSANDS1:2d$NUM-TEEN2A:2dNEXT1
l
mzweitausendzwölfnächstes
Frankfurt | dgskorpus_fra_11 | 18-30m   Next year, in 2012, there is supposed to be another parade.
rNEXT1$NUM-THOUSANDS1:2d$NUM-TEEN2A:2dNEXT1YEAR2A*ONCE-AGAIN2B*NEXT1
l
mzweitausendzwölfnächstesjahrn{och mal}nächstes
Frankfurt | dgskorpus_fra_11 | 18-30m   Next year, in 2012, there is supposed to be another parade.
rNEXT1YEAR2A*ONCE-AGAIN2B*NEXT1YEAR1BONCE-AGAIN2A
l
mnächstesjahrn{och mal}nächstesjahrnoch mal
Göttingen | dgskorpus_goe_07 | 18-30m   Then she did it again the next day.
rTO-DEVELOP1ATHEN1ANEXT1DAY1AONCE-AGAIN2B*TO-MAKE1
l
m[MG]dannnächstetagnoch malma{chen}
Göttingen | dgskorpus_goe_07 | 18-30m   Next year, it’s supposed/
rSHALL1COMING1NEXT1YEAR2A*
l
msollnächstejahr
Bremen | dgskorpus_hb_01 | 31-45m   Last year it was quite warm already; you could even wear a T-shirt. We'll see how the weather will be next time.
rSUMMER2T-SHIRT2TO-KNOW-OR-KNOWLEDGE2BNEXT1I1$GEST^TO-ORGANISE2A
l
msommer[MG]organ{isieren}
Bremen | dgskorpus_hb_04 | 18-30f   They looked different every time.
rNEXT1WHAT-DOES-THAT-MEAN1*NEXT1WHAT-DOES-THAT-MEAN1*
l
mnächstewasnächstewas
Bremen | dgskorpus_hb_04 | 18-30f   They looked different every time.
rNEXT1WHAT-DOES-THAT-MEAN1*NEXT1WHAT-DOES-THAT-MEAN1*DIFFERENT2*
l
mnächstewasnächstewasanders
Hamburg | dgskorpus_hh_03 | 46-60m   The next day at work, I instantly noticed the other people's behavior had changed. It was just different than usual.
rNEXT1DAY1A*I2FEELING3*
l
mnächstertag
Hamburg | dgskorpus_hh_03 | 46-60m   The next day at work, I instantly noticed the other people's behavior had changed. It was just different than usual.
rDAY1A*I2FEELING3*NEXT1DAY1A*I2TO-WORK1*
l
mtagnächsttagarbeit
Hamburg | dgskorpus_hh_04 | 46-60m   I think our generation can handle it but I feel sorry for the next generation.
rBOTH2A*$GEST^BUT2*NEXT1PEOPLE2*WHAT-DOES-IT-LOOK-LIKE1$GEST^
l
mfürabernächsteleutewie sieht aus
Hamburg | dgskorpus_hh_08 | 46-60f   “We’ll see each other next time, right?“
r
lTO-SEE1*NEXT1
msehen wir uns
Hamburg | dgskorpus_hh_08 | 46-60f   So next time we had our thirtieth class reunion coming up.
rNEXT1NOW2*
lSUDDENLY4^*NEXT1
mnächst[MG]nächstund dieses
Hamburg | dgskorpus_hh_08 | 46-60f   So next time we had our thirtieth class reunion coming up.
rNEXT1NOW2*
lSUDDENLY4^*NEXT1YEAR1B*$NUM-TENS2A:3d*
mnächst[MG]nächstund diesesjahrdreißig
Hamburg | dgskorpus_hh_08 | 46-60f   A few days later I was sitting at my desk in the company and received an email:
r$GEST^
lNEXT1TO-LIST1C^*DAY1A*
mnächstein paartag
Hamburg | dgskorpus_hh_08 | 46-60f   Next time, we will do a tour!
r$ORAL^NEXT1ON-PERSON1TO-LEAD1A*
l
mmussnächstes mal auf dich fü{hren}
Hamburg | dgskorpus_hh_08 | 46-60f   Next time, I will show you.
rNEXT1TO-LEAD1A*THIS1A*
l
mnächstes malführensamuel heinick{e}
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   But I am planning to go to the U.S. with my wife next year anyway.
rI2PLAN2SOMETIME1^NEXT1YEAR2ASUMMER3SHALL1
l
mplannächstesjahrsommersoll
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   The next pageant is in California in May of 2012.
rNEXT1YEAR2A$GEST-TO-PONDER1^*MAY5A
l
mnächstjahrmai
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   She said, her CI surgery is later, on the third or fourth of December.
rCI1^OPERATION1A*$INDEX1NEXT1$GEST-TO-PONDER1^$NUM-ORDINAL1:4*$NUM-ORDINAL1:3d
l
mc-io-pvierte
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   I'm curious to see what they make out of the one in Erfurt.
rI1INTEREST1ANEXT1ERFURT1$GEST-OFF^*
l
merfurt
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   The next Deaflympics are in Greece [sic].
rNEXT1GREECE1*
l
mnächstegriechenland
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   That’s why I‘d like my children to enroll next year when they are six years old so they don‘t fall behind.
rTHEREFORE1NEXT1TO-MAKE-UP-FOR-STH1$INDEX1TO-WISH1A
l
mdarumnächstes jahraufholenwünsch
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   I see, next year.
rNEXT1
l
mnächste
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   They‘ll be in Erfurt. You could go there together.
rNEXT1ERFURT1YOU1CULTURE1A*
l
merfurtkulturtag
Köln (Cologne) | dgskorpus_koe_21 | 61+m   What now?
rNEXT1STEP1*
l
mnächsteschritt
Leipzig | dgskorpus_lei_02 | 61+f   My brother is the oldest; he was born in #193X. I’m the second one and was born in #193X. The last one was born in #193X.
r$NUM$NUM-TENS1:3dI1NEXT1$NUM$NUM-TENS1:3d*
l
mich#xdreißig
Leipzig | dgskorpus_lei_03 | 18-30m   I‘m not sure when I‘ll do it, maybe in August.
rI1NEXT1THEN1AWHEN2NEXT1*
l
mdannwann
Leipzig | dgskorpus_lei_09 | 31-45f   I worked in Dessau back then.
rTO-WORK2
lNEXT1PAST-OR-BACK-THEN1*I1
mfrüherarbeite
Leipzig | dgskorpus_lei_10 | 31-45m   Right, shouting at them does not work, you have to find a different way.
rTO-URGE1SAME5*IT-WORKS-OUT1*NEXT1BRAIN1A^DIFFERENT2^*TO-SEARCH1*
l
mselbeklapptdann mussanderssuch
Leipzig | dgskorpus_lei_10 | 31-45m   That is why we were told, ”never again” would they hire a deaf person.
rHENCE1NEXT1TO-COME1DEAF1ATO-WORK2
l
mdeshalbnächstes malkommarbeit
Leipzig | dgskorpus_lei_11 | 31-45f   We are planning on going there for the second time very soon.
rNEXT1$NUM-ORDINAL1:2dPROCEEDING1^FURTHER1A*
l
m[MG]zweitew{eiter}
Leipzig | dgskorpus_lei_12 | 61+m   Afterwards I went to Chemnitz to work at the daily paper “Freie Presse” [lit. Free Press].
rTHEN6*NEXT1BEARD2B^*$INDEX1DAY1A
l
mdannchemnitztageszeitung
Leipzig | dgskorpus_lei_12 | 61+m   If the atmosphere is as good next time, I‘ll go there for sure.
rI1NEXT1I1IF-OR-WHEN1AGOOD1
l
mwennnächste malwenngut
Leipzig | dgskorpus_lei_14 | 31-45m   I assume, next/
rTO-SEE1*TO-STAY3*NEXT1
l
mblei{ben}nächste
Leipzig | dgskorpus_lei_14 | 31-45m   I think we’ll talk about that again in September.
rNEXT1SEPTEMBER2B*ONCE-AGAIN1TALK3
l
mglaube nächsteseptem{ber}noch mal[MG]
Leipzig | dgskorpus_lei_14 | 31-45m   Soon, on the first of July, I’m going to Nuremberg with two other deaf people.
rI1SOON1*NEXT1$INDEX1DEAF1A$NUM-NUMBER-OF-PEOPLE1:3d*
l
m[MG]näch{ste}
Leipzig | dgskorpus_lei_14 | 31-45m   No, soon Toyota is supposed to join as the fourth/
rNOT3B*$LIST1:1of1d*SHALL1*NEXT1$LIST1:4of4d*IN-ADDITION1*$LIST1:4of4d
l
msoll
Leipzig | dgskorpus_lei_14 | 31-45m   This time, I’ll stand further to the front.
r$GEST-NM-SHAKE-HEAD1^I1SOON1*NEXT1$GEST-NM-SHAKE-HEAD1^I1*DIFFERENT2
l
mich[MG]ichander
Leipzig | dgskorpus_lei_14 | 31-45m   My wife asked me whether I wanted to go again.
rNEXT1$GEST-OFF^$GEST^
l
m
Leipzig | dgskorpus_lei_15 | 18-30f   And next/ No, this year, it will take place in Erfurt, right?
rNEXT1YEAR2ANO1ATHIS2
l
mnächstesjahrneindies
Leipzig | dgskorpus_lei_15 | 18-30f   The next day the ”Türkisparade” [turquois parade] took place, I think, yes, the Türkisparade.
rTHEN1ANEXT1DAY1ATO-BELIEVE2AWAS1*
l
mnächstetagglaubewar
Leipzig | dgskorpus_lei_15 | 18-30f   The next day the ”Türkisparade” [turquois parade] took place, I think, yes, the Türkisparade.
rTO-BELIEVE2AWAS1*MASS-OF-PEOPLE-ACTIVE8*NEXT1DAY1A*MASS-OF-PEOPLE-ACTIVE8*
l
mglaubewardanntag
Münster | dgskorpus_mst_01 | 46-60m   I then took off the hearing aid on the left side and felt better the next day.
rTOMORROW1BVANISHED1B*I1NEXT1ALL1A^
l
mmor{gen}[MG]am nächste
Münster | dgskorpus_mst_02 | 18-30f   We would do that the next day.
rNEXT1DAY3*
l
mam nächstentag
Münster | dgskorpus_mst_06 | 31-45m   Ever since that experience it’s been carved into my head: You have to use sunscreen, especially at the sea.
rOCEAN1BCOHERENCE3
lNEXT1I1
mmeer
Münster | dgskorpus_mst_06 | 31-45m   In four years the games will be held in Greece.
rGREECE1
lNEXT1$NUM-YEAR-AFTER-NOW1:4NEXT1
mnächstevier jahrenächstegriechenland
Münster | dgskorpus_mst_06 | 31-45m   In four years the games will be held in Greece.
rGREECE1
lNEXT1$NUM-YEAR-AFTER-NOW1:4NEXT1I1SOON2
mnächstevier jahrenächstegriechenland
Münster | dgskorpus_mst_06 | 31-45m   Only three more years.
rSTILL1ASTILL1A
lNEXT1$GEST-TO-PONDER1^*$INDEX1
mnochnoch
Münster | dgskorpus_mst_15 | 31-45f   If they liked it, they possibly want to see it again next year.
rTO-WISH1B*ONCE-AGAIN2BTO-SEE1NEXT1CHRISTMAS4A*POSSIBLE1*
l
mwünschnoch malsehnächstweihnachtmö{glich}
Münster | dgskorpus_mst_15 | 31-45f   A door opens, and new contacts arise from it.
rMORE1*OPEN-DOOR4AFOR1*NEXT1TO-COME3*TO-COME3*
l
mmehrtür aufnächste[MG][MG]
Münster | dgskorpus_mst_15 | 31-45f   Yes, the upcoming year.
r$GEST-NM-NOD-HEAD1^NEXT1YEAR1B$GEST-NM-NOD-HEAD1^
l
mnäch{stes}jahr
Münster | dgskorpus_mst_16 | 61+m   “Next year you will go to Büren.”
r$INDEX1NEXT1TO-PLACE1*TO-EAT-OR-FOOD2^
l
mnächstes jahrnachbüren
München (Munich) | dgskorpus_mue_03 | 46-60m   When Pope John Paul died a little while later, I was wondering who would become the next pope.
rTO-PONDER1*PRESENT-OR-HERE1WHO4NEXT1POPE-$CANDIDATE-MUE49^*
l
m[MG]dawernächstespapst
München (Munich) | dgskorpus_mue_03 | 46-60m   There was a meeting of with all deaf believers the next day.
rNEXT1DAY1ATHEN1A*TOGETHER1A*
l
mam nächstentagdannzusammen
München (Munich) | dgskorpus_mue_07 | 18-30m   The Oktoberfest is a tradition; it’ll soon celebrate its 200th birthday.
rOKTOBERFEST1*TRADITION4*CELEBRATION1A*BIRTHDAY7
lNEXT1$NUM-HUNDREDS1:2YEAR2A
moktoberfesttraditionfestzweihundertjahrgeburtstagsfeier
München (Munich) | dgskorpus_mue_07 | 18-30m   Next year the smoking ban will be implemented, this year it’s still allowed but not next year anymore.
r$INDEX1TO-SMOKE1AALLOWED1NEXT1YEAR2A*TO-SMOKE1APROHIBITED1
l
mrauchdarfnächstesjahrrauchverbot
München (Munich) | dgskorpus_mue_07 | 18-30m   This will be the last year. They’re planning the ban for next year.
rLAST1ATO-SMOKE1A*ALLOWED1*NEXT1PROHIBITED3PLAN2YES2
l
mletztedarfnächstesjahrgeplant[MG]
München (Munich) | dgskorpus_mue_07 | 18-30m   Then there’re the alps and the Zugspitze.
rNEXT1$PRODALPS1*$GEST-OFF^
l
malp
München (Munich) | dgskorpus_mue_08 | 18-30f   And then we returned the TV the week after.
rTHEN1ANEXT1WEEK2ONCE-MORE1A*BACK1A*
l
mdanndannwiederzurück
München (Munich) | dgskorpus_mue_13 | 46-60m   I was surprised that those fourteen days at the facility were supposed to start the following Friday already.
r$GEST-NM^FAST3A*FRIDAY1ANEXT1ALREADY1A
l
msch{nell}freitagnächste wocheschon
München (Munich) | dgskorpus_mue_13 | 46-60m   I told my girlfriend that I wasn’t even prepared to be sent away all of a sudden.
rPLAN2*BOTH1*I1*NEXT1TO-SEND-OR-TO-DISPATCH1I1
l
mplannächsteschick
Rostock | dgskorpus_mvp_02 | 31-45m   Next winter will be fine, but not this year.
rNEXT1YEAR2AAFTER2BWINTER1*
l
mnächstesjahrnach
Rostock | dgskorpus_mvp_03 | 18-30m   During the next summer break, I visited my aunt who had fled from Eastern Germany before.
rNEXT1SUMMER8BHOLIDAYS2TO-GO-THERE2*
l
mnächstesommerferien
Rostock | dgskorpus_mvp_06 | 61+m   If there was anything important, they would come to me and ask whether I would join the next trip, for example.
rIMPORTANT1*TO-LET-KNOW1ANEXT1TRIP-$CANDIDATE-MVP22^$GEST^$GEST-NM^
l
mwichtigbescheid[MG]ausflugund so weiter[LM:ah]
Rostock | dgskorpus_mvp_06 | 61+m   All I had to do was gather the shopping trolleys and organise them.
r$ORAL^WAGGON2*NEXT1WAGGON2TO-TIDY1*TO-PUT-STH-DOWN1
l
mnureinräumen
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   So, each way is going to be a three-lane road.
rTO-COME1NEXT1$NUM-ONE-TO-TEN1A:3d*$PROD
l
mkommnächstdrei[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   I will try again next year to get my own seller stand again.
r$GEST^THEN2BWHAT-DOES-IT-LOOK-LIKE1NEXT1YEAR2B*WHAT-DOES-IT-LOOK-LIKE1ONCE-AGAIN2A*
l$GEST-DECLINE1^*
m[MG]wie sieht ausnächstesjahrnoch mal
Nürnberg (Nuremberg) | dgskorpus_nue_02 | 61+f   I/ Now or soon a book will be published that will tell whether it's a man or a woman.
rSOON2^TO-COME1*SHALL1*NEXT1BOOK1BI1GENUINE1
l
mkommsollnächsteecht
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I went back to Germany on Sunday, and on the day before - Saturday - I went to a Deaf football club with another deaf person.
rI1$INDEX1I1NEXT1BEFORE1GI2SATURDAY4*
l
msamstag
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Will you be driving to Munich on Saturday?
rTO1YOU1*SATURDAY4*NEXT1
l
msamstag
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Yes, I’m going to leave on Friday; I have the day off.
rYES2NEXT1FRIDAY4DEPARTURE1FRIDAY4*
l
mjafreitagfreitag
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Yes, I’m going to leave on Friday; I have the day off.
rFRIDAY4*VACATION2*I1NEXT1FRIDAY4*DEPARTURE1$INDEX1
l
mfreitagurlaubfreitag
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Next weekend?
rNEXT1WEEKEND3*
l
mnächstewochenende
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Well, it’s my boyfriends birthday the week after.
rDARLING1DAY-AFTER1A^*BIRTHDAY5NEXT1$INDEX1
l
m[MG]geburtstag
Nürnberg (Nuremberg) | dgskorpus_nue_06 | 31-45f   Alright, the next day comes.
rNEXT1DAY1BWHAT1A
l
mnächstertagwas
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   What will it look like at the folk festival?
rWHAT-DOES-IT-LOOK-LIKE1*NEXT1ALL2D^*TO-GO-THERE2*$GEST-OFF^*
l
mwie {sieht} ausvolksfest
Schleswig-Holstein | dgskorpus_sh_01 | 18-30m   Do you want to talk about the next topic?
r$GEST^NEXT1SUBJECT1*
l
mnächstethema
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   If I know that I simply have that disease, I know that it’s going to get better eventually.
rTO-OWN1*$GEST-DECLINE1^*NEXT1BETTER1*$GEST-OFF^*$GEST-NM^*
l
m[MG]achnächstewieder besser[MG]
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   If I have another appointment the next day, I’ve spent 200 euros already.
rNEXT1$INDEX1DAY1A
lONCE-AGAIN2A
mnäch{ster}tagnoch einmal
Schleswig-Holstein | dgskorpus_sh_05 | 61+m   I couldn't go there for my next vacation.
rI1NEXT1I1VACATION6CAN2A*
l
michnächste wocheurlaub
Schleswig-Holstein | dgskorpus_sh_05 | 61+m   No one can tell what happens today, tomorrow or the next time, whether there will be another earthquake or not.
rTOMORROW1ATODAY1NEXT1TO-STAY2I1*TO-KNOW-OR-KNOWLEDGE2A*
l
mmorgenheutenächstes malblei{ben}wissen nicht
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   I hope it will be a lot better the next time.
rI1TO-HOPE1CNEXT1BETTER1*
l
michhoffenächstes malbesser
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   Just imagine the appointment being changed to the following week and by then I would have felt better, then the doctor could not have examined me.
rCOINCIDENCE1^$PROD$PRODNEXT1APPOINTMENT1B*TO-POSTPONE4*BETTER1
l
mnächste wocheterminbesser
Stuttgart | dgskorpus_stu_01 | 46-60f   I‘m going to relearn how to knit next Thursday.
rNEXT1DAY-CALENDAR3A^I1NEXT1
l
mnächstendonnerstag
Stuttgart | dgskorpus_stu_01 | 46-60f   I‘m going to relearn how to knit next Thursday.
rNEXT1DAY-CALENDAR3A^I1NEXT1TO-LEARN1I2*ONCE-AGAIN2A*
l
mnächstendonnerstaglernennoch mal
Stuttgart | dgskorpus_stu_01 | 46-60f   It‘s next week.
rTO-SHOW1ANEXT1
l
mnächste woche
Stuttgart | dgskorpus_stu_01 | 46-60f   She told me that she going to run the half marathon next time around, on April 12th in Berlin.
rTOGETHER3A*$INDEX1NEXT1$NUM-ORDINAL1:2dAPRIL4*TO-PLACE1
lTO-LET-KNOW1A*
mnächstenzweitenapril
Stuttgart | dgskorpus_stu_01 | 46-60f   And I said, “I‘m not sure yet whether I‘ll be there or not.”
rINSECURE1TO-KNOW-OR-KNOWLEDGE2BI1^NEXT1WITH1ATO-DRIVE1^
l
mweiß nichtobnächstemit
Stuttgart | dgskorpus_stu_01 | 46-60f   Soon, in 2010, ‘11 the new winter season starts.
rSOON3*NEXT1$NUM-THOUSANDS1:2d$NUM-ONE-TO-TEN1A:10$NUM-TEEN2A:1d
l
m[MG]nächstezweitausendzehnelf
Stuttgart | dgskorpus_stu_01 | 46-60f   If it had been like that, she would turn 50 next year.
rIF-OR-WHEN1AYEAR2A*NEXT1$NUM-TENS2A:5*$GEST-OFF^
l
mwärenächstesfünfzig
Stuttgart | dgskorpus_stu_05 | 61+m   Next time we will go to Ludwigshafen again.
r
lNEXT1TO-BELIEVE2ANEXT1ONCE-MORE1A
mnächste malglaubennächstewieder
Stuttgart | dgskorpus_stu_05 | 61+m   Next time we will go to Ludwigshafen again.
r
lNEXT1TO-BELIEVE2ANEXT1ONCE-MORE1AI1TO1
mnächste malglaubennächstewieder
Stuttgart | dgskorpus_stu_05 | 61+m   I’ve already told my wife I won’t go to the senior’s meeting this year, but that I do want to go next year.
r
l$GEST-OFF^*COMING1FAIRLY1NEXT1I1EYE1^TO1
m[MG][MG]nächste[MG]freiburg
Stuttgart | dgskorpus_stu_06 | 18-30f   There’s always next year.
rNEXT1YEAR2AANYWAY1*TO-COME1
l
mnächstejahrsowieso
Stuttgart | dgskorpus_stu_06 | 18-30f   I’ll come again next year, also to Munich/
rNEXT1YEAR2AI1TO-COME1*
l
mnächstejahrich
Stuttgart | dgskorpus_stu_06 | 18-30f   And you want to go to Namibia with me next year. I need to factor that in, as well.
rAND2A*YOU1TO-WANT1BNEXT1YEAR2ATOGETHER3A*$ALPHA1:N*
l
mundduwillnäch{ste}jahrnam{i}bia
Stuttgart | dgskorpus_stu_06 | 18-30f   #Name6 also wants to go on vacation with me next year, but it’s only going to be a small trip.
rAND2A$NAMETO-WANT1BNEXT1YEAR2ATOGETHER3A*ALSO3A*
l$INDEX1
mund#name6willnä{chste}jahrauch
Stuttgart | dgskorpus_stu_06 | 18-30f   I also thought about the things I have planned for the next year.
rI1TO-THINK1BTO-PONDER1*NEXT1YEAR2A
l$NUM-ONE-TO-TEN1A:1d$NUM-ONE-TO-TEN1A:1d$NUM-ONE-TO-TEN1A:1d$NUM-ONE-TO-TEN1A:1d
m[MG]nächstejahr
Stuttgart | dgskorpus_stu_11 | 46-60m   Luckily, one of the brothers was able to go with the firefighters into the first tower and film everything.
rWHO3FIRE-BRIGADE1ON-PERSON1*NEXT1OFTEN1BFIRE1A*$INDEX1
l
mwerfeuerwehrnächsten maloftfeuer
Stuttgart | dgskorpus_stu_12 | 46-60f   The next one is in Freiburg.
rNEXT1FREIBURG1
l
mnächstefreiburg
Stuttgart | dgskorpus_stu_12 | 46-60f   It was in Freiburg once, after that in Heidelberg, and the most recent one took place in Hamburg.
rLAST4^FREIBURG1NEXT1HEIDELBERG1NEXT1*A-MOMENT-AGO1
l
meinmalfreiburgheidelberg
Stuttgart | dgskorpus_stu_12 | 46-60f   It took me half an hour to shop in one of them, and half an hour in the next one.
rHALF6THEN5*NEXT1STORE1HALF6
l$INDEX1
mhalbe stundedannnächstegeschäfthalbe stunde
Stuttgart | dgskorpus_stu_13 | 31-45f   I’ll correct all mistakes from first grade on as soon as our next child starts school.
rIF-OR-WHEN1ANEXT1$LIST1:3of3dSCHOOL1A*TO-JOIN1A*
l
mwennnächsteschule
Stuttgart | dgskorpus_stu_13 | 31-45f   I said “Yes” and the next time I still didn't know where to find it on the map.
rI1$GEST-NM-NOD-HEAD1^NEXT1TO-KNOW-OR-KNOWLEDGE2A*$INDEX1*$GEST-DECLINE1^
l
mjaweiß nicht[MG]
Stuttgart | dgskorpus_stu_13 | 31-45f   The following story is bad and a little embarrassing.
rNEXT1BAD3A*TO-BE-SILENT3^EMBARRASSING2
l
mnächsteschlimmpeinlich
Stuttgart | dgskorpus_stu_16 | 31-45f   The following month, the money was once again handed to you in an envelope.
rTO-PUT-IN2^TO-DISTRIBUTE3^*
lNEXT1TOGETHER3A^
mnächstenmonat
Stuttgart | dgskorpus_stu_17 | 31-45f   The next day, I wanted to go swimming, for example, getting to know the culture, or see the Vatican or museums.
rTHEN1A*I1NEXT1DAY1A*I1^*TO-GO-THERE1
l
mdann[MG]nächstert{ag}schwimmen
Berlin | dgskorpus_ber_04 | 46-60m   I'll also organize the German Deaf Sports Days 2012 in Berlin.
rAND-THEN2$LIST1:2of2dNEXT1*I1ALSO3A*TO-ORGANISE2A
l$NUM-ORDINAL1:2d
mundzweitenächstichauchorganisieren
Berlin | dgskorpus_ber_09 | 18-30f   If the affairs can’t accept that, then it has to be ended.
rAFFAIR1*$INDEX1*NEXT1*PRESENT-OR-HERE1*MUST1*TO-LET-KNOW1A*
l$INDEX1$INDEX1$INDEX1
maff{äre}damuss
Berlin | dgskorpus_ber_10 | 31-45m   Then we’re good to go.
rTHEN1A*$INDEX1*NEXT1*I1*WELL1*I1*
l
mdann[MG]
Berlin | dgskorpus_ber_11 | 61+m   My sister also has a hearing child, you never know what will happen in the next generation.
rBIRTH1AHEARING1A$INDEX1*NEXT1*GENERATION1THEN1AWHAT-DOES-THAT-MEAN1
l$INDEX1$INDEX1
mkindhörendabernächstegenerationdannwas
Berlin | dgskorpus_ber_12 | 31-45f   Now I am the one who worries, because both of my kids are deaf as well.
rNOW1*I1THOUGHTS1NEXT1*MY1CHILD2*$NUM-ONE-TO-TEN1A:2*
l
mjetztkinderzwei
Berlin | dgskorpus_ber_14 | 18-30f   It was also not clear if I had to go to school.
rINSECURE1*SCHOOL1A
lAND2A*NEXT1*THERE1*
mundun{sicher}schul
Frankfurt | dgskorpus_fra_05 | 46-60m   Hopefully, someday it will work out for me to join them.
rTO-HOPE1A*$INDEX1*NEXT1*TO-HOPE2A*I1
l
mhoffehoffentlich
Göttingen | dgskorpus_goe_07 | 18-30m   It was all over the papers the next day.
r$GEST-DECLINE1^*NEXT1*DAY1A$INDEX1NEWSPAPER1A
l
mnächstetagzei{tung}
Bremen | dgskorpus_hb_04 | 18-30f   The next day the program started.
rNEXT1*DAY1AGO-START2*THERE1*
l
mnächstertaglos
Bremen | dgskorpus_hb_04 | 18-30f   Not this, but next year.
rTHIS2YEAR2B*NEXT1*YEAR2A*
l
mnicht diesesjahrnächstesjahr
Bremen | dgskorpus_hb_04 | 18-30f   Oh no, sorry, yes, next year.
rNEXT1*YEAR2B*$GEST-TO-TAP-ONES-FOREHEAD1^APOLOGY1
l
mnächstestschuldigung
Bremen | dgskorpus_hb_04 | 18-30f   Oh no, sorry, yes, next year.
rYEAR2B*$GEST-TO-TAP-ONES-FOREHEAD1^APOLOGY1NEXT1*YEAR2B
l
mtschuldigungnächstesjahr
Bremen | dgskorpus_hb_06 | 31-45f   I switched to the second channel and it showed the same images.
rREMOTE1*
l$NUM-ORDINAL1:2dNEXT1*SAME1
mzweiteprogrammselbe
Bremen | dgskorpus_hb_08 | 61+m   We also went on quite a few excursions - always for four or five days.
rNEXT1*TRIP2*$GEST-DECLINE1^*$NUM-ONE-TO-TEN1A:5*
l
mausflugvielf{ünf}
Hamburg | dgskorpus_hh_02 | 31-45f   On another level questions might come up, about the grandparents, and about potential siblings.
rHIS-HER1*NEXT1*WHAT-DOES-THAT-MEAN1*$INDEX1TO-OWN1
l
mwas[MG]
Hamburg | dgskorpus_hh_08 | 46-60f   Gunter was supposed to organize a trip on the Spree [river in Berlin].
rSPREE-RIVER1*TO-ORGANISE2A*$GEST^NEXT1*
l$INDEX2
mspree
Hamburg | dgskorpus_hh_08 | 46-60f   “For next time,“ Gunter said, “of course, I’ll do that, it’s going to be so special in Berlin, 30 years!“
rNEXT1*
l$NAME-GUNTER-PUTTRICH1*YES1AI1
mnächstgunter puttrich
Hamburg | dgskorpus_hh_08 | 46-60f   I’ll take you on a tour.
rNEXT1*TO-LEAD1A*ON-PERSON1
l
mnächstes mal führen
Hamburg | dgskorpus_hh_08 | 46-60f   That meant that his nearer future was completely unclear.
rFOR1*NEXT1*TO-KNOW-OR-KNOWLEDGE2BHOW-QUESTION-COMPARISON1*SHALL1
l
mweißnicht wiesoll
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   So, next year/
rNEXT1*$GEST^
l
mnächstesjahr
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   I’ll wait a little while and will set up an appointment sometime soon.
rTO-WAIT3NEXT1*I1TO-DO3SOMETIME1*
l
mabwartentueirgendwann
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   Later in Denmark we won the gold medal as well.
rNEXT1*DENMARK1ALSO1A*TO-ACCOMPLISH1A
l
mdänemarkauch
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   After that they were held in Cologne.
rNEXT1*COLOGNE2
l
mköln
Köln (Cologne) | dgskorpus_koe_21 | 61+m   The forth were held in Cologne and the fifth, next year, will take place in Erfurt.
r$LIST1:4of4d*COLOGNE2*$LIST1:4of4dNEXT1*NOW1*NEXT1*YEAR1A
l
mkölnnächste jahr
Köln (Cologne) | dgskorpus_koe_21 | 61+m   The forth were held in Cologne and the fifth, next year, will take place in Erfurt.
r$LIST1:4of4dNEXT1*NOW1*NEXT1*YEAR1A$LIST1:5of5*ERFURT1*
l
mnächste jahrerfurt
Leipzig | dgskorpus_lei_03 | 18-30m   I‘m not sure when I‘ll do it, maybe in August.
rNEXT1THEN1AWHEN2NEXT1*$GEST-I-DONT-KNOW1^AUGUST3A*MAYBE1*
l
mdannwann[MG]augustvielleicht
Leipzig | dgskorpus_lei_11 | 31-45f   After he was born, I don't know whether it was on the same day or the day after/
rEQUAL8*TODAY1OR6B*NEXT1*DAY1AI2*$GEST-OFF^
l
mgleichheuteodernächstertagweiß nicht
Leipzig | dgskorpus_lei_11 | 31-45f   You could give me the tour next time.
rYOU1NEXT1*TO-LEAD1A*YOU1*
l
mnächst{es} malführen
Leipzig | dgskorpus_lei_14 | 31-45m   I hope we’ll manage to get someone from the junior department in, soon.
r$GEST^*NOW1$GEST^NEXT1*TO-SAY1OFFSPRING1*COME-HERE1*
l
mjetzt[MG]sagtnachwuchskommt
Münster | dgskorpus_mst_01 | 46-60m   The issue is raised again at the election campaign.
rELECTION1C*FIGHT1A*CLEAR1BNEXT1*$GEST-OFF^
l
mwahlkampfklar
Münster | dgskorpus_mst_06 | 31-45m   Austerity measures and the amount of time are relatively short to manage everything in two years.
rREASON4ATO-SAVE2HOW-QUESTION-COMPARISON1*NEXT1*$NUM-YEAR-AFTER-NOW1:2$GEST-OFF^TO-SEE1^*
l
mgrundsparma{ßnahmen}wie[MG][MG]
Münster | dgskorpus_mst_13 | 46-60f   My uncle—my father’s brother—signed as well and teased me with signs while I was growing up.
r$INDEX1*FATHER3*BROTHER1ANEXT1*TALK2B*$INDEX1*I2
l
mm{ein}bru{der}[MG]me{in}
Münster | dgskorpus_mst_15 | 31-45f   The next meeting, I signed the lyrics of the song to the children. They were completely captivated by it.
rTO-GO-THERE1*NEXT1*TO-MEET1I1TO-GO-THERE1*
l
mnächstetreff[MG][MG]
Münster | dgskorpus_mst_15 | 31-45f   Maybe it is planned for next year, as well. They might contact you again before Christmas.
rMAYBE3*NEXT1*CHRISTMAS4ABETWEEN1C*ONCE-AGAIN2B*
l
mvielleichtnächstesweihnachten[MG]noch mal
München (Munich) | dgskorpus_mue_04 | 18-30f   Then I went to Japan which was completely different.
rNEXT1*JAPAN1
l
mjapan
München (Munich) | dgskorpus_mue_04 | 18-30f   Then I went to New York.
rNEXT1*NEW-YORK1*I1
l
mnew york
München (Munich) | dgskorpus_mue_04 | 18-30f   I tried turtle in Cuba.
rNEXT1*$GEST-TO-PONDER1^CUBA1TURTLE1
l
mkubaschildkröte
München (Munich) | dgskorpus_mue_07 | 18-30m   From that day on the contact with hearing people got more and more and now I communicate with hearing people on a daily basis.
rNEXT1*NOW3*NEXT1*MORE3
l
mjetzt[MG]
München (Munich) | dgskorpus_mue_07 | 18-30m   From that day on the contact with hearing people got more and more and now I communicate with hearing people on a daily basis.
rNEXT1*NOW3*NEXT1*MORE3HEARING1A*CONTACT2B
l
mjetzt[MG]hörendkontakt
München (Munich) | dgskorpus_mue_09 | 61+f   Then I have to pull myself together and need to take better care of them.
r$GEST-DECLINE1^*NEXT1*I1*CARE5AI1
l
m[MG]nächstemalpflegeich
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   The years after, all the places were always already taken.
rTHEN1BI1NEXT1*OCCUPIED-OR-OWNED2*AFTERWARDS2A^*
l
mund dannbesetzt besetzt besetzt besetzt
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   It’s soon - on the 10th of July.
rNEXT1*$NUM-ONE-TO-TEN1B:10JULY17B*HERE1*
l
mzehn{ter}juli
Nürnberg (Nuremberg) | dgskorpus_nue_06 | 31-45f   The next day, the woman is putting decorations on a small cake.
rNEXT1*DAY1BDIFFERENT1$GEST-OFF^
l
mnächstertaganders[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_06 | 31-45f   Whether I went on holidays abroad.
rNEXT1*WAS1$ALPHA1:FABROAD4*
l
mwarausland
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   The next day, there was a lot in the papers and a few days later, I didn't feel queasy anymore.
rNEXT1*DAY-AFTER1B^NEWSPAPER1ANEWSPAPER3
l
mnächstzeitung
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   At the next Sports Festival in Hamburg, everybody really wanted to join.
rBUT1*NEXT1*SPORTS1*CELEBRATION3A*IN1
l
m[MG]sportfestin
Schleswig-Holstein | dgskorpus_sh_05 | 61+m   Next up this topic.
rNEXT1*
l
m
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   And/
rYOU1*NEXT1*POOR-YOU1*$GEST-AGREEMENT1^
l
ma{rm}
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   What's also very bad is that the flag wasn't initially to be at half-mast during her funeral.
rNEXT1*BAD3A*POOR-YOU1FUNERAL1*
l
mschlimmarmbeerdigung
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   Diana also didn't like Fergie, her sister-in-law.
rAN1ARELATED1A^*$INDEX1*
lNEXT1*
meinschwägerin
Stuttgart | dgskorpus_stu_01 | 46-60f   I told her that I‘d like to book a place for the upcoming Thursday, November 11th.
rDAY-CALENDAR3A^I1*TO-SHOW1ANEXT1*$NUM-TEEN2A:1d*I1^*TO-BOOK1*
l
mdonnerstagelftenovember[MG]
Stuttgart | dgskorpus_stu_01 | 46-60f   The knitting will start next Thursday night at half past six.
rNEXT1*DAY-CALENDAR3A^HALF1A$NUM-ONE-TO-TEN1A:7d
l
mnächstendonnerstaghalbsieben
Stuttgart | dgskorpus_stu_02 | 18-30f   People are thankful for my assistance, but I also explain to them that it can't always go like this.
rALSO1ATHANKS2*I2*IMAGINATION3*$INDEX1I2*
lNEXT1*
mauchdanke dankenächstes malvorstellen
Stuttgart | dgskorpus_stu_03 | 31-45m   Maybe it will come to me in the near future. I don't know.
r$GEST-OFF^AFTERWARDS1A^*$GEST-OFF^NEXT1*TIME1$GEST-I-DONT-KNOW1^TO-KNOW-STH-OR-SB1B*
l
mvielleichtkommtnächsterzeitichweiß nicht
Stuttgart | dgskorpus_stu_05 | 61+m   Next year on the 6th of January I will go to Singen again.
rI1*NEXT1*$NUM-ONE-TO-TEN1B:6dJANUARY5AONCE-AGAIN2A
l
mnächstesechsjanuarnoch mal
Stuttgart | dgskorpus_stu_06 | 18-30f   I will probably know in the beginning of December when the appointments are.
rCERTAIN2*I1TO-LEARN-STH1BNEXT1*DECEMBER3A*HOW-QUESTION-COMPARISON1^APPOINTMENT1A*
l
merfahrendezemberwann
Stuttgart | dgskorpus_stu_06 | 18-30f   The turn of the year is right around the corner, as well.
rNEXT1*YEAR2A*PROCEEDING1A*
l
m
Stuttgart | dgskorpus_stu_12 | 46-60f   It was in Freiburg once, after that in Heidelberg, and the most recent one took place in Hamburg.
rFREIBURG1NEXT1HEIDELBERG1NEXT1*A-MOMENT-AGO1HAMBURG2$INDEX1
l
mfreiburgheidelberghamburg
Stuttgart | dgskorpus_stu_14 | 46-60m   Who didn't stand to the rules, wasn't even allowed to watch the first half.
r$INDEX1*TO-SLIDE-OR-TO-PUSH2^*NEXT1*PENALTY1ATO-DECREASE1^*NO2B*
l
m[MG]strafe[MG]
Stuttgart | dgskorpus_stu_14 | 46-60m   We even had to go to church on the first and the second feast day.
rNEXT1*$NUM-ORDINAL1:1d$NUM-ORDINAL1:2dCHRISTMAS4A*
l
merstezweiteweihnacht
Stuttgart | dgskorpus_stu_14 | 46-60m   Even on January 1st we had to be in church very early.
rNEXT1*$NUM-ORDINAL1:1dJANUARY4*EARLY2*
l
merstejanuarfrüh
Stuttgart | dgskorpus_stu_14 | 46-60m   It’s just the same as on 6th of January, on Three Kings' Day, where we went to a nursing home.
rNEXT1*$NUM-ONE-TO-TEN1B:6dJANUARY4*FOREIGN3^
l
msechsjanuaraltenheim
= SOON6
Berlin | dgskorpus_ber_10 | 31-45m   I’m soon going to be self-employed, and the integration office granted me 1,500 euros per month.
rI1SOON6SELF1A*TO-STAND1HENCEFORTH1*
l
mselbststän{dig}
Hamburg | dgskorpus_hh_08 | 46-60f   Nowadays, when I have guests, when friends visit me, the first thing we do is a go on a tour through Speicherstadt [City of Warehouses].
rMORE1*SOON6FRIEND1*
lNOW1*IF-OR-WHEN1ATO-OBTAIN1*TO-VISIT-OR-TO-ATTEND2
mjetztmehrwennbekommtbes{uch}freund
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Any news on the ski meet-up soon?
rTO-TINKER1A^*
lSOON6TO-SEE1SKI1^*
mbaldsehski
Leipzig | dgskorpus_lei_10 | 31-45m   We got married quickly back then. Now we’ve been married for 20 years already, soon to be 21 years, oh well.
r$NUM-TENS1:2YEAR1B*$GEST-OFF^SOON6$NUM-ONE-TO-TEN1A:1d$NUM-TENS1:2dWHATEVER3*
l
mjahr[MG]egal
Leipzig | dgskorpus_lei_14 | 31-45m   Do you know that the Formula One is on, soon?
rYOU1*TO-STRIKE1ASOON6SOON7$ALPHA1:F$NUM-ONE-TO-TEN1A:1d
lWHAT1A
m{auf}fallbaldformel eins
Leipzig | dgskorpus_lei_14 | 31-45m   Soon, March 8th.
rSOON6$NUM-ONE-TO-TEN1B:8d*MARCH11*
l
machtmärz
Münster | dgskorpus_mst_15 | 31-45f   It is going to start this fall.
rSOON6AUTUMN1A*GO-START1*HENCEFORTH1
l
mherbstlos
Stuttgart | dgskorpus_stu_05 | 61+m   #Name6 was really fat, though. I asked #Name7, if he would be ready to come soon, e.g. to Freiburg.
r$INDEX1READY1*$GEST-NM-TO-SHRUG1^*SOON6$INDEX1TO1*
l$NUM-ONE-TO-TEN1A:1d*
mbereitfreiburg
Stuttgart | dgskorpus_stu_13 | 31-45f   All this new stuff - nothing doing.
rSOON6NEW4ATO-FORGET1$GEST-DECLINE1^*
l
m[MG]neukannst du vergessen
Frankfurt | dgskorpus_fra_16 | 31-45f   Last Saturday, I went to a meeting, because a group of deaf people and I were planning the upcoming carnival.
rDEAF1A*GROUP2A*PREPARATION2*SOON6*FASCHING1*TO-CELEBRATE1PREPARATION1A
l
mvorbereitenfasch{ing}vorb{ereiten}
Göttingen | dgskorpus_goe_07 | 18-30m   In Europe, power stations are solidly installed, and no one is protesting and requiring their closing.
r$GEST-OFF^DEMONSTRATION3*TO-LEARN-STH1ASOON6*
lOFF1A
m[MG]baldab
Köln (Cologne) | dgskorpus_koe_22 | 46-60m   He was going to retire soon, and they were looking for a successor.
r$INDEX1SOON6*PENSION5TO-SEARCH1*TO-FOLLOW1B
l
mbaldrentesuchennachfolger
Leipzig | dgskorpus_lei_03 | 18-30m   It‘s been almost 13 years since then.
rALREADY1A
l$NUM-TEEN1:3dSOON6*$NUM-TEEN1:3dYEAR1B*$GEST-OFF^*
mschondreizehndreizehnjahre
Leipzig | dgskorpus_lei_03 | 18-30m   No, it was 13 years ago.
r
lSOON6*WAS1$NUM-TEEN2A:3dYEAR2A
m[MG]wardreizehnjahre
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   Me and a couple of others are planning on going to the beer festival soon, to a tent, to celebrate and drink.
rTO-WANT8PLAN2*BEER1*CELEBRATION3A*TENT2*
lTO-LIST1CSOON6*
m[MG]willplanbierfestzelt
= THEN1A
Berlin | dgskorpus_ber_01 | 18-30m   Then I was sad about it all.
rI1
lTHEN1A$INDEX1BIT2B*
mdannbisschen
Berlin | dgskorpus_ber_02 | 46-60m   If they didn't have a job, they thought it would be better to restore the Berlin wall.
rI1*TO-WORK2*FALL-OF-THE-BERLIN-WALL2THEN1AMOMENT3*OFF5*TO-WORK1*
l
mmauer{fall}momentarbeitslos
Berlin | dgskorpus_ber_03 | 46-60f   I approached him and asked whether he hadn’t heard anything new, and told him that there had been some sad news today.
rTHEN1A$PRODI2YOU1*
l
m[MG][MG]
Berlin | dgskorpus_ber_04 | 46-60m   So, after the first half of the match.
rFIRST-OF-ALL1AHALFTIME2*GAME-PLAY1BTHEN1ATO-COME1*RELAY4CIRCLE1B^
l
mersthalbzeit[MG]dannkommstaffel
Berlin | dgskorpus_ber_04 | 46-60m   In 1989 the Deaflympics were in New Zealand.
rTHEN1A$NUM-ONE-TO-TEN1A:9$NUM-TENS4A:8d*IN1*
l
mneunundachtzigin
Berlin | dgskorpus_ber_04 | 46-60m   In 2005 the Deaflympics were in Melbourne, Australia.
rTHEN1A$NUM-THOUSANDS1:2d$NUM-ONE-TO-TEN1A:5IN1*
l
mzweitausendfünfin
Berlin | dgskorpus_ber_06 | 31-45m   That went on until I left school after tenth grade, then/
rUNTIL1*$NUM-GRADE1:10*ENDING2ATHEN1A
l$NUM-ONE-TO-TEN1A:1d
mbisklasse zehnschlussdann
Berlin | dgskorpus_ber_07 | 31-45m   One has to leave early to get there and then spend the whole day there and drive back home into the city the next.
r$NUM-ONE-TO-TEN1B:1d*DAY1A*STAY1*THEN1ADAY1A*BACK1A*MIDDLE2A^*
l
meintag[MG]danntagzurückstadt
Berlin | dgskorpus_ber_08 | 46-60f   Then I started an apprenticeship, that was in Berlin, too.
rEDUCATION1
lTHEN1APROFESSION1ABERLIN1B
mdannberufsausbildungberlin
Berlin | dgskorpus_ber_08 | 46-60f   Then I thought about which apprenticeship I should sign up for.
rI1PROFESSION1AWHAT1B
lTHEN1A
mdannberufwas was
Berlin | dgskorpus_ber_08 | 46-60f   I then started an apprenticeship with OTA [operating room nurse].
rPROCEEDING1^*EDUCATION1*
lTHEN1A$INDEX1$ALPHA1:O-T-A
mdannausbildungo-t-a
Berlin | dgskorpus_ber_09 | 18-30f   Then the bird swings happily back and forth in its cage.
rCAGE2*
lTHEN1ABIRD1*$INDEX1
m[MG]
Berlin | dgskorpus_ber_09 | 18-30f   The cat was still not able to do it.
rGOOD1*THEN1A$INDEX1*CAT1A*$GEST-NM-SHAKE-HEAD1^
l
m[MG]katze[MG]
Berlin | dgskorpus_ber_09 | 18-30f   Then the cat leaves and comes back with a wooden board.
rTHEN1ATO-GO-THERE1*TO-GET1A*WOOD6*
l
mdann[MG]holenholz
Berlin | dgskorpus_ber_09 | 18-30f   And then the cat gets a weight of 500 lbs.
rTHEN1A$INDEX1*$PROD$NUM-HUNDREDS1:5
l
mfünfhundert
Berlin | dgskorpus_ber_09 | 18-30f   So, the cat paces back and forth again and thinks hard.
r
lTHEN1ATO-WALK-AROUND1*TO-CONTEMPLATE2*
m[MG]
Berlin | dgskorpus_ber_09 | 18-30f   Then a grandma enters.
r
lTHEN1AGRANDMA1ATO-COME3
mdannoma
Berlin | dgskorpus_ber_09 | 18-30f   Now we see the cat dressed as a bellboy.
rCLOTHES3TYPICAL1*
lTHEN1A$INDEX1
mtypisch
Berlin | dgskorpus_ber_09 | 18-30f   The little bird confidently stands beside the grandmother and shouts as well.
rTHEN1ABIRD1TO-STAND1TO-RANT3A
l
mdannvogel[MG][MG]
Berlin | dgskorpus_ber_09 | 18-30f   When the cat arrives there as well, it acts again like the monkey.
rTHEN1ACAT1A*
lTO-COME-PASS1$INDEX1
mkatze
Berlin | dgskorpus_ber_09 | 18-30f   They were a couple and then/
rLIFE-PARTNER1TOGETHER-PERSON1*THEN1A$INDEX1
l
m[MG]dann[MG]
Berlin | dgskorpus_ber_09 | 18-30f   Then, the man enters the room, gets undressed as well, and the two of them have sex.
rTHEN1AMAN1TO-COME3*$PROD
l
mmann
Berlin | dgskorpus_ber_09 | 18-30f   What’s interesting as well is that, there, a woman gets pregnant, has a child, and then it just keeps going until she has a whole lot of kids.
rSELF1A*PREGNANT1BBIRTH1A*THEN1ATOGETHER3A*$NUM-ORDINAL1:1d$NUM-ORDINAL1:2d
l$INDEX1
m
Berlin | dgskorpus_ber_09 | 18-30f   Having sex just because you feel like it doesn’t really happen there.
rON-PERSON1DELIGHT1A*ALSO1A
lTHEN1A$INDEX1$INDEX1
mlustauch
Berlin | dgskorpus_ber_09 | 18-30f   After a year, a child is born, then they have sex and the next baby is on the way.
rYEAR3A*BIRTH1ADONE1BTHEN1ATOGETHER3A*THEN1A*BIRTH1A
l
mein jahr
Berlin | dgskorpus_ber_09 | 18-30f   Now they have a child, they’re a family.
rFAMILY1*
lTHEN1ACHILD1OFF1C^
mkindfam{ilie}[MG]
Berlin | dgskorpus_ber_09 | 18-30f   If a potential partner came along, maybe they didn’t agree with it.
rTHEN1A$PRODAPPROXIMATELY1^BECAUSE-OF2B
l
mdann[MG]wegen
Berlin | dgskorpus_ber_10 | 31-45m   Before I could go to work I had to be examined by a doctor at the airport. I had to put up with that.
r$INDEX1PHYSICIAN1EXAMINATION2A*THEN1AI1TO-GET-IN1TO-WORK1
l
marztuntersuchendannkannarbeiten
Berlin | dgskorpus_ber_10 | 31-45m   I guess the job centre thinks that it was my fault.
rTHEN1ATO-WORK2*AGENCY1CTO-LOOK-AT2*
l
mdannarbeitsamt
Berlin | dgskorpus_ber_11 | 61+m   My sister also has a hearing child, you never know what will happen in the next generation.
r$INDEX1*NEXT1*GENERATION1THEN1AWHAT-DOES-THAT-MEAN1$GEST-OFF^
l$INDEX1
mabernächstegenerationdannwas
Berlin | dgskorpus_ber_12 | 31-45f   The same thing happened last week.
rTHEN1ALAST5SAME2A
l
mdannletzt{e} wocheselbe
Berlin | dgskorpus_ber_13 | 31-45f   Then, I came along - being all inexperienced and about 25 years younger than him.
rTHEN1AI1TO-CHANGE2A^*TO-JUMP1^*
l
m[MG]stellver{treter}
Berlin | dgskorpus_ber_13 | 31-45f   Afterwards numbers increased again.
rTHEN7*SLOW1*THEN1ANOW1UPWARDS1*
l
mund dannwieder lang{sam}jetzt[MG]
Frankfurt | dgskorpus_fra_01 | 18-30m   When we were done with that, we came together as a group first.
rDONE1ATHEN1APEOPLE2COME-HERE1*$NUM-ONE-TO-TEN1B:5
l
mfertigleute
Frankfurt | dgskorpus_fra_01 | 18-30m   All members met to take the tram/ to join the apple cider city tour by tram.
rTHEN1ATOGETHER1B*MEMBER1FOR1
l
mdannmitgliedfür
Frankfurt | dgskorpus_fra_01 | 18-30m   After that the second event followed.
rDONE1ATHEN1A$LIST1:2of2dEVENT1*
l$NUM-ORDINAL1:2d$NUM-ONE-TO-TEN1A:2d*
mdannzweiteveranstaltung
Frankfurt | dgskorpus_fra_01 | 18-30m   After that the second event followed.
r$LIST1:2of2dEVENT1*$LIST1:2of2dTHEN1A
l$NUM-ONE-TO-TEN1A:2d*
mveranstaltung
Frankfurt | dgskorpus_fra_01 | 18-30m   They played in hall 2.
rAND-THEN2THEN1A$INDEX1FOOTBALL2*GAME-PLAY1B
l
mdannfußball[MG]
Frankfurt | dgskorpus_fra_01 | 18-30m   We went on organizing until the results were in - 1st, 2nd, 3rd, 4th place and so on.
rTHEN1AALL1A^*PEOPLE2ALL1A*
l
mwirleute
Frankfurt | dgskorpus_fra_01 | 18-30m   People of hall 2 had to come over really quickly then.
rTHEN1ATO-COME1*FAST2
l
mdannschnell
Frankfurt | dgskorpus_fra_01 | 18-30m   Then I went back to the counter to sell drinks.
rDONE1ATHEN1ABACK1A*TO-DRINK1*TO-SELL1*
l
mdannverkaufen
Frankfurt | dgskorpus_fra_01 | 18-30m   I had to go on stage again right after to participate in a game with Jürgen Endress.
rTHEN1AINTO2*WITH1ATO-MAKE2
l
mdannimmitmachen
Frankfurt | dgskorpus_fra_01 | 18-30m   After that, I went back to the counter and stayed there until early in the morning, until 3, 4 or 5 o clock.
rDONE1BTHEN1AUNTIL1
lI1BACK1A
mfertigdannzurückbis
Frankfurt | dgskorpus_fra_01 | 18-30m   What did all the members do then?
rTHEN1AALL1A*WHAT-ARE-YOU-DOING1MEMBER1
l
mdannallewas machtmitglied
Frankfurt | dgskorpus_fra_01 | 18-30m   The staff and members weren't allowed to drink during the event, that's why they drank during cleaning up.
rNOT3ALAST1ATO-TIDY1THEN1ALAST1BTO-DRINK1ALLOWED1*
l
mnichtletzteaufräumendannletztedarf
Frankfurt | dgskorpus_fra_01 | 18-30m   Only about 80 to 100 guests came to the event of the basketball players.
rTHEN1ATHEN1ABASKETBALL2*WAS1*
l
mbasketballwar
Frankfurt | dgskorpus_fra_01 | 18-30m   Only about 80 to 100 guests came to the event of the basketball players.
rTHEN1ATHEN1ABASKETBALL2*WAS1*$NUM-TENS2A:8d
l
mbasketballwarachtzig
Frankfurt | dgskorpus_fra_01 | 18-30m   The third event was a basketball match with an evening event afterwards.
r$LIST1:3of4BASKETBALL2TOURNAMENT1*THEN1AEVENING2*EVENT1*
l$NUM-ONE-TO-TEN1A:4*$NUM-ONE-TO-TEN1A:4*$NUM-ONE-TO-TEN1A:4*$NUM-ONE-TO-TEN1A:4*$NUM-ONE-TO-TEN1A:4*
mbasketballturnierdannveranstaltung
Frankfurt | dgskorpus_fra_01 | 18-30m   The fourth event was a gala evening as the closing event.
rTHEN1A$LIST1:4of4DOWN1^GALA2
l$NUM-ONE-TO-TEN1A:4*$NUM-ONE-TO-TEN1A:4*
mgalaabend
Frankfurt | dgskorpus_fra_01 | 18-30m   We went to the final event and the buffet was very special and a star, a magician named Falau, came.
rTHEN1ATO-CELEBRATE1*TO-COME1BUFFET1*
l$NUM-ONE-TO-TEN1A:4*
mbüfett
Frankfurt | dgskorpus_fra_01 | 18-30m   When everything was done, we cleaned up and that was the end of it.
rTOGETHER1B*END1^THEN1AOVER2A^*DONE4CLOSE-DOOR1
l
mfertigzu
Frankfurt | dgskorpus_fra_01 | 18-30m   Next time they can improve/
rTHEN1ATO-IMPROVE1WHAT1B*
l
mdannverbessernwas
Frankfurt | dgskorpus_fra_01 | 18-30m   It's almost been seven years now, last year it's been six.
rTHEN1A$NUM-ONE-TO-TEN1C:7dTHEN1ALAST5*
l
mdannsiebenletzte
Frankfurt | dgskorpus_fra_01 | 18-30m   It's almost been seven years now, last year it's been six.
rTHEN1A$NUM-ONE-TO-TEN1C:7dTHEN1ALAST5*YEAR1B*
l
mdannsiebenletztesechs jahre
Frankfurt | dgskorpus_fra_01 | 18-30m   Soon, it's been 10 years since then.
rALREADY1B*THEN1AYEAR1B*
l
mschondann
Frankfurt | dgskorpus_fra_02 | 31-45m   Then one can add the fingerspelling version of the word and keep on signing.
rONCE-AGAIN2AIN-ADDITION1*MANUAL-ALPHABET1*THEN1ATO-SIGN1A
l
mnoch malfingeralphabetdann
Frankfurt | dgskorpus_fra_02 | 31-45m   Back then I already understood the sign but they still fingerspelled it.
r$GEST-DECLINE1^I1TO-UNDERSTAND1THEN1AMANUAL-ALPHABET1*
l
m[MG]verstanden
Frankfurt | dgskorpus_fra_02 | 31-45m   For instance, “I need to take my car now but my car is broken which is why I borrowed my sister’s car. Then I drove to the doctor’s.“
rTO-BORROW1MY1*SISTER1ATHEN1AI1CAR-DRIVING2DEPARTURE1
l
mleihenschwesterfahren[MG]
Frankfurt | dgskorpus_fra_02 | 31-45m   Everything I sign is connected to one another and you can quickly grasp the context.
rPICTURE2BI1TO-SIGN1A*TO-SIGN1A*YOU1
lTHEN1ATHEN1A
mbilddannaber
Frankfurt | dgskorpus_fra_02 | 31-45m   Everything I sign is connected to one another and you can quickly grasp the context.
rTO-SIGN1A*TO-SIGN1A*YOU1AREA1A*APPROXIMATELY3
lTHEN1ATHEN1A
mdannaberungefähr
Frankfurt | dgskorpus_fra_02 | 31-45m   This exchange was supposed to show respect for each other everywhere.
rTHEN1AWHAT-DOES-THAT-MEAN1*TO-TAKE1A^*RESPECT1A*
l
mwasrespekt
Frankfurt | dgskorpus_fra_03 | 46-60m   Later/ Ah yes, in Frankenthal I did sports in school and during the breaks.
rTHEN1ALATER10$GEST^I1
l
mdannspäter[MG]
Frankfurt | dgskorpus_fra_04 | 61+m   They forwarded it to the Gallaudet University, who invited me.
rUNIVERSITY2*SELF1ATO-SEND-OR-TO-DISPATCH2*THEN1AI1TO-INVITE2$GEST-NM-NOD-HEAD1^
l
munivers{ität}anm{ich}eingeladen
Frankfurt | dgskorpus_fra_04 | 61+m   Then we traveled there in a group.
r$GEST-DECLINE1^*GROUP1A*$GEST-OFF^
lTHEN1ATO-GO-THERE1
mdann[MG]
Frankfurt | dgskorpus_fra_04 | 61+m   I informed them there would be a deaf guy coming.
rTHEN1A$INDEX1
lTO-LET-KNOW1A*DEAF1A
mdann[MG]deaf
Frankfurt | dgskorpus_fra_05 | 46-60m   My father told me that he will show me his work in his firm soon.
rMY1FATHER1*$GEST-NM-TO-SHRUG1^THEN1AMY1COMPANY1A*TO-WORK2*
l
mmeinvaterauch
Frankfurt | dgskorpus_fra_05 | 46-60m   You even have to name the hotels you’re staying at. Then, you’re allowed to enter.
rTO-REGISTER1NAME1B*HEADING1^*THEN1AI1AIRPLANE2B*
l
madresseflie{gen}
Frankfurt | dgskorpus_fra_05 | 46-60m   Then I will retire.
rTHEN1APENSION1*$GEST-OFF^
l
mrente
Frankfurt | dgskorpus_fra_06 | 31-45f   The next morning I met my three deaf colleagues from work.
r$GEST-DECLINE1^*$GEST-TO-PONDER1^THEN1ANEXT1MONDAY13ATHEN1A
l
mnächstmontagdann
Frankfurt | dgskorpus_fra_06 | 31-45f   The next morning I met my three deaf colleagues from work.
rTHEN1ANEXT1MONDAY13ATHEN1ATO-WORK2*SCHOOL4^DEAF1B*
l
mnächstmontagdannarbeitkollegen[MG]
Frankfurt | dgskorpus_fra_06 | 31-45f   They came to the conclusion that I was ready to go to school, much to the surprise of my mother.
r$INDEX1*THEN1AI1TO-SEND-OR-TO-DISPATCH1*SCHOOL1B
l
m[MG]schule
Frankfurt | dgskorpus_fra_06 | 31-45f   Sometimes I had to think about it first and then I remembered and told her that we had bratwurst or schnitzel, for instance.
rMUM11*THERE-IS3*SAUSAGE1ATHEN1ASCHNITZEL2
l
m[MG]gibtbratwurstdannschnitzel
Frankfurt | dgskorpus_fra_06 | 31-45f   Once we were done with that, we sat down and ate. Afterwards, they started congratulating. No, sorry, it was the other way around.
rDONE1BTHEN1ATO-CONGRATULATE1B*$ORAL^DINNER1*
l
mdannerstabendbrot
Frankfurt | dgskorpus_fra_06 | 31-45f   Then I started my apprenticeship which was a whole new experience for me, interacting with hearing people.
rTHEN1AEDUCATION1*ATTITUDE3*NEW1A
l
mdannausbildneu
Frankfurt | dgskorpus_fra_07 | 18-30m   Once I don't feel like working out anymore, or I am sick of the stuff listed above, I could take an interest in culture.
rWELL1ANYWAY1CULTURE1A*
lENOUGH1*THEN1AI1INTEREST1A
msowie{so}und dann[MG]kul{tur}[MG]
Frankfurt | dgskorpus_fra_08 | 18-30f   Later, I communicated with friends using sign language and gestures.
rAFTERWARDS1A^*CHANGE-OF-SUBJECT1*THEN1A$GEST-OFF^*AND2AFRIEND7*
l
mdanachundfreunde
Frankfurt | dgskorpus_fra_08 | 18-30f   Then/
rTHEN1A
l
mdann
Frankfurt | dgskorpus_fra_08 | 18-30f   Joined, er, yes, joined/
rTHEN1A$GEST-NM-TO-WIGGLE-ONES-HEAD1^$GEST-NM-NOD-HEAD1^TO-JOIN1B
l
mdann[MG]
Frankfurt | dgskorpus_fra_08 | 18-30f   That’s when I realized that it didn’t help my general education.
rTO-CHANGE1B*THEN1AI2AWARE1*NO3B^
l
mumdannbewusst
Frankfurt | dgskorpus_fra_08 | 18-30f   I was told that, because I have a CI, I would have to be hard of hearing.
rTHEN1ATO-LET-KNOW1A*CI1$INDEX1
l
mdannsagtc-i
Frankfurt | dgskorpus_fra_08 | 18-30f   After school, during my educator training, everybody else was also deaf.
rTHEN1AI1*NOW1*MOMENT1*
l
mdannichjetzterzieherausbil{dung}
Frankfurt | dgskorpus_fra_08 | 18-30f   When I gave my part to them on a flash drive, I distinctly asked that it would be added to the final term paper.
rI1TO-PLUG2^*TO-GIVE-HOLD-ON-TO1A*THEN1ATO-GIVE-HOLD-ON-TO1A*THEN6I1
l
mgebendanngebendann
Frankfurt | dgskorpus_fra_08 | 18-30f   After the weekend, on Monday, I didn’t go to university because I wasn’t feeling well.
rEND1A$INDEX1$GEST-OFF^*THEN1AMONDAY13ABEEN1*I2*
l
mdannmontag
Frankfurt | dgskorpus_fra_08 | 18-30f   I was allowed to sign with them.
rTO-SIGN1GTHEN1A
l
m[MG]dann
Frankfurt | dgskorpus_fra_08 | 18-30f   I asked them, “Why?“
rTHEN1APARENTS1A*I2*TO-SAY1^*
l
mdann
Frankfurt | dgskorpus_fra_08 | 18-30f   They told me that if I had a deaf boyfriend, the next generation, my children, would automatically also be deaf.
rIF-OR-WHEN1ADEAF1ABOYFRIEND-GIRLFRIEND1THEN1ATHEN1A*GENERATION4*CLOSE-BY1^*
l
mwenndannnächstegenerationnachwuchs
Frankfurt | dgskorpus_fra_10 | 61+f   Afterwards, I was working for a dry cleaning company for a year.
rTHEN8TO-WORK2THEN1ACLEANING1A*$INDEX1YEAR1B*
l
mdannarbeitendannreinigungein jahr
Frankfurt | dgskorpus_fra_11 | 18-30m   When I was a bit older, my grandma began to look after me during the day.
rTO-GROW-UP1B*$GEST-TO-PONDER1^THEN1ATO-THROW1^*GRANDMA1C
l
mdannoma
Frankfurt | dgskorpus_fra_11 | 18-30m   Later on, I went to a kindergarten for hearing children.
rTO-DEVELOP2*THEN1AI1*TO-MOVE1*$GEST-NM-SHAKE-HEAD1^
l
mdann
Frankfurt | dgskorpus_fra_11 | 18-30m   I thought the same thing, until I had finished school and went to vocational school for about two years.
rPERIOD1D*SCHOOL1ATO-DISMISS1*THEN1APROFESSION1A*IN-ADDITION1*YEAR1B*
l
mschuleentlassendannberufzwei jahre
Frankfurt | dgskorpus_fra_11 | 18-30m   I visited him and families and so on.
rTHEN1AI1TO-VISIT-OR-TO-ATTEND1B*HIS-HER1*
l
mund dannbesuche
Frankfurt | dgskorpus_fra_12 | 61+m   But my father got called up and had to go to Poland because of a lack of people in leading positions there.
rAFTERWARDS1A^*THEN1AI1^FATHER7*TO-PUT1
l
mvater
Frankfurt | dgskorpus_fra_12 | 61+m   We used them to make oil that we gave the teachers. That’s how they’d teach me.
rCONTAINER1A^*CONTAINER1A^*$INDEX1*THEN1ACONTAINER1A^*TEACHER1*
lTO-PUT1*
möldannöllehrer
Frankfurt | dgskorpus_fra_12 | 61+m   One day - it was time to work - I just didn't feel like it.
rTHEN1CTHEN1AI1TO-KNOW-OR-KNOWLEDGE2AI1
l
mweiß
Frankfurt | dgskorpus_fra_14 | 31-45f   True, and when you finished the program I held my talk.
rRIGHT-OR-AGREED1ADONE2*THEN1AI1LECTURE1
l
mstimmtfertigdann[MG]
Frankfurt | dgskorpus_fra_14 | 31-45f   Until everything is understood and the school runs well.
rUNTIL1CLEAR1AAND2A*THEN1ASCHOOL1APROCEEDING1^I1
l
mbisklarschule
Frankfurt | dgskorpus_fra_16 | 31-45f   I was riding my bike when suddenly the handlebar turned to the right: I passed a parking car by a whisker and bumped into its side mirror - the mirror snapped off.
rFURTHER1B*ATTENTION1$PRODTHEN1AMIRROR1*$PRODATTENTION1
l
mweiter[MG]spiegelab
Frankfurt | dgskorpus_fra_16 | 31-45f   Kennedy's two younger brothers were killed, as well. One was shot as well, and the other one was killed in a car accident.
rDOWN6^*ALSO3ATO-SHOOT1E*THEN1ACAR1*$PROD
l
m[MG]auch[MG]dannauto[MG]
Göttingen | dgskorpus_goe_01 | 61+m   I couldn't keep on playing afterwards, I knew that.
rTHEN1ACAN1*
l
mdanachkann nicht
Göttingen | dgskorpus_goe_01 | 61+m   I only go swimming for fun now.
rTHEN1AI2*NOW1*QUOTATION-MARKS1*
l
mjetzt
Göttingen | dgskorpus_goe_01 | 61+m   During my rehabilitation I learned Nordic walking.
rTHEN1ACURE1$INDEX1HAVE-AUXILIARY1*
l
mdannkurhabe
Göttingen | dgskorpus_goe_01 | 61+m   Actually, I wish to keep on doing sports but can't do it alone.
r$ORAL^THEN1ALIKE1ALONE2*TO-GO1A*
l
maberdannwieallein[MG]
Göttingen | dgskorpus_goe_01 | 61+m   It's also a problem for me that hearing people can call for help via their cell phones. And I, as a deaf person, can't. Therefore it is important that I have a partner with me while doing sports.
rPROBLEM2AWHO3*TO-MATCH1THEN1ACAN1MOBILE2*TO-HELP1*
l
mproblemwerpasstdannkannhandyhelfen
Göttingen | dgskorpus_goe_04 | 31-45m   I signed up for it, and then we just did it.
rI1MESSAGE-OR-NOTIFICATION1$GEST-OFF^*THEN1AWITH1A*TO-MAKE1*THROUGH2A
l
mgemeldetmitmachendurch
Göttingen | dgskorpus_goe_04 | 31-45m   I understood that they were from England, and I told them that I‘m from Germany.
rENGLAND3THEN1AI1GERMANY-INTS1*I1
lRIGHT-OR-AGREED1A*$INDEX1TO-BELONG1^*
mstimmenglandgermany
Göttingen | dgskorpus_goe_04 | 31-45m   My daughter proudly showed me her graded assignment. I looked at it surprised and happily.
rI1DOCUMENT-OR-CERTIFICATE2*$INDEX1THEN1AI1
lTO-LEAF-THROUGH2*
mzeugnis
Göttingen | dgskorpus_goe_04 | 31-45m   I had my family first and then/
rAREA1A^*PRESENT-OR-HERE1*THEN1A
l
mdadann
Göttingen | dgskorpus_goe_07 | 18-30m   We filmed all of that, edited it together and prepared it for the power point presentation at the informational booth.
rCAMERA1*DONE1ATHEN1ATO-WORK1MOVIE1SEGMENT2A^*
l
m[MG]dannfilm[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   The next day everything started.
rTO-SWARM1THEN1ATOMORROW1BGO-START1
l
mdannmorgenlos
Göttingen | dgskorpus_goe_07 | 18-30m   Then she did it again the next day.
rTO-DEVELOP1ATHEN1ANEXT1DAY1AONCE-AGAIN2B*
l
m[MG]dannnächstetagnoch mal
Göttingen | dgskorpus_goe_07 | 18-30m   In the evening, there was theater, poetry, entertainment, the gala, but I wasn’t there for any of that.
rTHEN1AEVENING2PROGRAM1B*$GEST-OFF^
l
mabendprogramm
Göttingen | dgskorpus_goe_07 | 18-30m   Then, the second point: The jury is made up of several deaf and, I think, two hearing people.
rTHEN1AFOR1$LIST1:2of2dTO-TICK1A^*
l
mdafürjury
Göttingen | dgskorpus_goe_07 | 18-30m   That was great, there was a large buffet and some interviews.
rWEIRD1GREAT1ATHEN1ATO-EAT-OR-FOOD1BUFFET1APPLAUSE2^*
l
m[MG]tolldannessen[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   Then he was supposed to go to the winter olympics which will be on soon.
rTHEN1AUSUAL1*A-MOMENT-AGO1SHALL1
l
mdannnormal[MG]soll
Göttingen | dgskorpus_goe_07 | 18-30m   There we can exchange thoughts, hold a seminar, maybe do some sports or a city tour during our time off.
rTO-REPLACE1SEMINAR1LECTURE1THEN1ALEISURE1B*TOGETHER7SPORTS1*
l
m[MG]seminardannfrei{zeit}[MG]sport
Göttingen | dgskorpus_goe_07 | 18-30m   In order to do so, they darken the room, then you put your chin into this sort of retainer and cover one eye.
rMEANING1ROOM1BDARK2THEN1A$PRODPIRATE1^
l
mbedeutetraumdunkeldannzu
Göttingen | dgskorpus_goe_07 | 18-30m   They were different examinations of the eye, measurements of the brain, precise visual distance and lots more.
rI1EXAMINATION2A*$PRODTHEN1ANEXT-TO1A*FARSIGHTEDNESS1B^*EXACTLY2
l
michdann[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   When we were done, we had a final conversation with the leading professor.
rDONE1ATHEN1AGRADUATION-OR-COMPLETION1TALK3WITH1A
l
mdannabsch{luss}[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   He wanted to read through them for five minutes before he could give us some answers.
r$NUM-ONE-TO-TEN1A:5MINUTE1TO-READ-BOOK2ATHEN1AANSWER1*OKAY1A*
l
mfünfmin{uten}lesenund dannantwortokay
Göttingen | dgskorpus_goe_07 | 18-30m   At home my parents called in something of a family conference.
rGO-HOME1THEN1APARENTS1A*LIKE3A*FAMILY4
l
mnach hauseelternwiefamilienkonferenz
Göttingen | dgskorpus_goe_07 | 18-30m   Okay.
rTHEN1AOKAY1A*
l
mokay
Göttingen | dgskorpus_goe_07 | 18-30m   Later, they found a homepage that said there was a possible surgery in Cuba.
rTHEN1ALATER10*I1EXAMINATION2B
l
mspäter
Göttingen | dgskorpus_goe_07 | 18-30m   I was confused, the culture in Cuba was completely different.
rTHEN1ATO-BE-CONFUSED1DIFFERENT1CULTURE1A*
l
m[MG]anderskultur
Göttingen | dgskorpus_goe_08 | 18-30f   And then/
rTHEN1A$INDEX1
l
mdann
Göttingen | dgskorpus_goe_08 | 18-30f   I don't book him again, never ever.
rTHEN1ANOT-AGAIN1*PERSON1NOT-AGAIN1*
l
mnie wiedernie wieder
Göttingen | dgskorpus_goe_08 | 18-30f   You don’t book him again.
rTHEN1AONCE-MORE1B*
l
mdannwieder
Göttingen | dgskorpus_goe_08 | 18-30f   With building a new university you could gather researchers from all over Europe.
rTHEN1ATO-FOUND2RESEARCH1AHOW-QUESTION-COMPARISON1
l
mgründenforschenwie
Göttingen | dgskorpus_goe_08 | 18-30f   And then/
rTHEN1A
l
mdann
Göttingen | dgskorpus_goe_08 | 18-30f   You bring them in, and they can try to find words to be signed uniformly in Europe.
rTO-GET1ATHEN1ATO-TRY2WORD3*TO-PRODUCE2^
l
mholenversuchenwort[MG]
Göttingen | dgskorpus_goe_08 | 18-30f   You can also use SL/ no BSL in a scientific context.
rUNIVERSITY1$INDEX1RESEARCH1A*THEN1A$ALPHA1:S-LBSL1COPY1A^
l
munidannb-s-lb-s-l
Göttingen | dgskorpus_goe_08 | 18-30f   You can add new signs or change them.
rTHEN1ASELF1ATO-PRODUCE2^*IN-ADDITION1
l
mdannselbst[MG]
Göttingen | dgskorpus_goe_08 | 18-30f   They know all the words then and learn faster while reading.
rTO-KNOW-OR-KNOWLEDGE2A*EVERYTHING1BWORD3THEN1AI2TO-READ-BOOK1DTO-KNOW-OR-KNOWLEDGE2B*
l
mweißallewortdannlesenweiß
Göttingen | dgskorpus_goe_08 | 18-30f   Most implanted people have headaches afterwards.
rMOST1ACI1*THEN1APERSON1^MOST1AHEAD1B*
l
mmeistc-idameistkopfschmerzen
Göttingen | dgskorpus_goe_08 | 18-30f   He had a CI surgery, and removed it later.
rBEEN1*CI1*OPERATION1BTHEN1ACI2^*CI-TO-GIVE-UP1
l
mgewesenc-iop{eration}ab
Göttingen | dgskorpus_goe_09 | 61+f   I wait a little and after a day I add a little more water again.
rTO-WAIT1ATHEN1AALWAYS4A*I1$NUM-ONE-TO-TEN1A:1
l
mwartendannimmerein
Göttingen | dgskorpus_goe_09 | 61+f   Then we had soup again, and more rice pudding.
rTHEN1ASOUP1*MILK2C*
l
msuppemilchreis
Göttingen | dgskorpus_goe_09 | 61+f   I was then forced to finish it.
rTHEN1AMUST1COMPULSION1*TO-EAT-OR-FOOD2*
l
mdannmussess
Göttingen | dgskorpus_goe_09 | 61+f   But entering the hearing world and working with hearing people all the time made me unhappy.
rATTENTION1A^*BUT1THEN1AREALLY2*HEARING1AWORLD1
l
m[MG]aberdann[MG]hörendwelt
Göttingen | dgskorpus_goe_10 | 46-60m   As the event was finished, we went to another room in the same building were there was a disco.
rTHEN1ADONE1ADONE1AALL1A*
l
mdannfertigfertigalle
Göttingen | dgskorpus_goe_10 | 46-60m   Deaf Way II was held during our vacation there.
rTHEN1ABETWEEN1B*MEASURE-HORIZONTAL1^*DEAF-ASL1*
l$INDEX1
mdanndazwischendeaf way
Göttingen | dgskorpus_goe_10 | 46-60m   After the event we had a lot of free time.
rTHEN1ADONE1BLEISURE1B*UNTIL1^
l
mdann
Bremen | dgskorpus_hb_01 | 31-45m   Well and then/
rYES2*THEN1A$INDEX1*
l
mund dann
Bremen | dgskorpus_hb_01 | 31-45m   I knew many deaf people, as we used to live near the boarding school, but in Essen it was even better.
rALREADY1BPARENTS1ABACK-AND-FORTH1^*THEN1AESSEN-CITY1*TO1^$GEST^
l
mschoneltern[MG]dannessen[MG]
Bremen | dgskorpus_hb_03 | 31-45f   A lot of people wait until they are like eight, nine or ten to get their CI implanted.
r$NUM-ONE-TO-TEN1A:8d$NUM-ONE-TO-TEN1A:9d$INDEX1THEN1ACI1*$INDEX1
l
machtdann[MG]
Bremen | dgskorpus_hb_03 | 31-45f   When they get a CI for one ear and they are getting another one on the other side, they face reactions like, “Did you have to get the second one as well? Are you talking, too?”
rCI1THEN1ATO-LET-KNOW1A*WHY1$NUM-ORDINAL1:2d
l$NUM-ORDINAL1:2d*CI1*
mzweitesdannbescheidwarumzweites
Bremen | dgskorpus_hb_03 | 31-45f   If you were to do it the other way around: if you were to focus on spoken language first and want to learn sign language afterwards, I think that is harder.
rLOUD1A*LANGUAGE1FOCUS1THEN1ATO-SIGN1A*BIT2A*HEAVY1B
l
mlautsprachedanngebärdenbisschenschwerer
Bremen | dgskorpus_hb_04 | 18-30f   I remember, I had theme-work teaching at that time and the Youth Festival happened right in the middle of it.
rSUDDENLY4I1WAS1
lTHEN1A
mdann[MG]war
Bremen | dgskorpus_hb_04 | 18-30f   Right, I went to Frankfurt and everyone met up there.
rI2*UNTIL1*$INDEX1THEN1ATO-MEET1FRANKFURT1*
l$INDEX1
m[MG]bisdanntreffenfrankfurt
Bremen | dgskorpus_hb_04 | 18-30f   We arranged where to sleep, and then first of all, we all went to sleep.
r$INDEX1TO-MEET1THEN1ATOGETHER1A*ANYTHING1*TO-SLEEP1A*
l
m[MG]treffendann[MG]schlafen
Bremen | dgskorpus_hb_04 | 18-30f   There was, for instance, a talk about/
rTHEN1ADIFFERENT2*LECTURE1*SUBJECT1
l
manderervortragsthemen
Bremen | dgskorpus_hb_04 | 18-30f   And a couple years later a civil war started in the US.
rTHEN1ACOURSE-OF-TIME1SUDDENLY4*WAR1A
l
mdann[MG]krieg
Bremen | dgskorpus_hb_04 | 18-30f   And when he became president it was JFK's goal to establish equality and a bond and even more between the different people.
r$INDEX1GO-START1BOSS3THEN1ATO-WISH1BMORE3*INCORPORATION1
l
mdalosdannwunschmehr
Bremen | dgskorpus_hb_04 | 18-30f   At the end of the festival/ It was from Friday until Sunday; there was a program throughout these days.
rTHEN1AI1SUDDENLY4*ENDING4
l
mich[MG]schluss
Bremen | dgskorpus_hb_04 | 18-30f   And now Obama is on the same path.
rYES2THEN1ANOW3*$NAME-BARACK-OBAMA1$INDEX1
l
mjaund dannjetztobama
Bremen | dgskorpus_hb_04 | 18-30f   As soon as they left the stage, the program started.
rDEVIATION3^*THEN1APROGRAM1B*CONTINUOUS1*
l
m[MG]dannprogramm programm[MG]
Bremen | dgskorpus_hb_04 | 18-30f   There were many different items on the program.
r$GEST^THEN1AMUCH-OR-MANY1A*DISTINCT1*PROGRAM1B
l
m[MG]dannvielverschiedeneprogramm
Bremen | dgskorpus_hb_04 | 18-30f   The camera then followed the tracks again up into infinity.
rSOURCE1A^*THEN1ATO-FOLLOW1A*$INDEX1$PROD
l
m[MG]dannfolgtauf die spurenspuren
Bremen | dgskorpus_hb_04 | 18-30f   This is portrayed in many movies, where one person is hired to kill another one, but that hit man hires another on and so on and so forth to the actual murderer.
rSOMETIMES2*AND-THEN1*TO-LET-KNOW1ATHEN1ATO-LET-KNOW1ATHEN1ATO-LET-KNOW1A
l
mmanchmalund[MG]danndann
Bremen | dgskorpus_hb_04 | 18-30f   This is portrayed in many movies, where one person is hired to kill another one, but that hit man hires another on and so on and so forth to the actual murderer.
rTO-LET-KNOW1ATHEN1ATO-LET-KNOW1ATHEN1ATO-LET-KNOW1ATHEN1A*$INDEX1
l
m[MG]danndanndann dann dann
Bremen | dgskorpus_hb_04 | 18-30f   One had to retrace every single man of the chain to get to the murderer.
r$INDEX1TO-CATCH-SB1A$INDEX1*TO-CATCH-SB1ATHEN1A*
lTHEN1A*THEN1A
mdanndann
Bremen | dgskorpus_hb_04 | 18-30f   Next time they came back all brash and signed casually and like having swag when making the next announcement and then left again.
rTHEN1ALIKE-THIS1ATO-STAND1$GEST-OFF^
l
mdannauftritt
Bremen | dgskorpus_hb_04 | 18-30f   Then they came back looking fashionable.
rTHEN1ATO-CHANGE1A*$PROD
l
mdannum
Bremen | dgskorpus_hb_04 | 18-30f   One change after the other.
rTO-SWAP6TO-SWAP1A*MUCH-OR-MANY1ATHEN1ATO-SWAP1A*
l
mwechsel[MG]vielumwechsel
Bremen | dgskorpus_hb_05 | 61+f   My parents went home.
rTHEN1AGO-HOME2
l
mdannnach haus
Bremen | dgskorpus_hb_05 | 61+f   We see each other once a week. We meet up then.
rTHEN1AI1*TO-SEE-AGAIN1*OFTEN1A*
l
mdannoft
Bremen | dgskorpus_hb_05 | 61+f   It goes on and on.
r$INDEX1THEN1ACOURSE-OF-TIME1*
l
mdann
Bremen | dgskorpus_hb_05 | 61+f   Then they saw him with the CI.
rTHEN1ATO-SEE1*CI1$GEST^
l
mdannsehenc-i
Bremen | dgskorpus_hb_05 | 61+f   His mother says she regrets it now.
rTHEN1A$INDEX1*HIS-HER1MOTHER1*
l
mdannmutter
Bremen | dgskorpus_hb_06 | 31-45f   Then, up there/
rTHEN1AABOVE1^
l
mdann
Bremen | dgskorpus_hb_06 | 31-45f   And others, others/
rTHEN1ADIFFERENT2DIFFERENT1
l$INDEX1
mda{nn}andere
Bremen | dgskorpus_hb_07 | 18-30m   They were able to get together through the frog’s getaway.
rTHROUGH2B*FLIGHT1ATHEN1ANEW1ACOUPLE1
l
mdurchfliehenneupaar
Bremen | dgskorpus_hb_07 | 18-30m   The frog takes a big leap out of the glass and flees.
rNO3A^*TO-JUMP1*$PRODTHEN1AFLIGHT1AOFF-OR-AWAY1AWAY1*
l
m[MG][MG][MG][MG]
Bremen | dgskorpus_hb_07 | 18-30m   I took the theory test first and then I started my driving lessons.
rTO-WRITE1A*PROCEEDING2$PRODCAR-DRIVING2
lTHEORY1ATHEN1A$INDEX1*
mtheoriedannrumfahren
Bremen | dgskorpus_hb_07 | 18-30m   There was an interpreter during the actual exam. That worked out really well.
rTHEN1CTHEN1AINTERPRETER1TO-HIRE1BI1
l
mdolmetscher
Bremen | dgskorpus_hb_08 | 61+m   I thought the Berlin Wall would fall some time later, but it had already fallen the day before.
r$INDEX1*WALL3ALREADY1ABEFOREHAND2
lOPINION1ATHEN1A
mmeintmauerschonvorher
Hamburg | dgskorpus_hh_01 | 61+m   I cut a piece off of it, took a bite and asked myself where the white icing had gone.
rMAYBE1*THEN1AI1$PROD$PROD
l
mvielleichtkalt
Hamburg | dgskorpus_hh_03 | 46-60m   And suddenly they also showed how in the meantime one plane flew into the Pentagon, and also how another plane was hijacked.
r$INDEX1THEN1A*THEN1ASUDDENLY4*TO-SHOW1A*ONLY2A
l
mdanndann[MG]zeigennur
Hamburg | dgskorpus_hh_03 | 46-60m   They were split into a women's group, a men's group, and a group for the children.
rIN-ADDITION1WOMAN1A*TO-HIRE1A*THEN1AMISTER1THEN1A*CHILD2*
l
mzufrauenherrenkinder
Hamburg | dgskorpus_hh_03 | 46-60m   I was relieved, because if this had been a real war - what would have happened?
rTO-CHANGE2ATO-SIT1AWHAT-DOES-IT-LOOK-LIKE1I1$GEST^
lTHEN1A
mumsetzenwie sieht ausdann
Hamburg | dgskorpus_hh_04 | 46-60m   When I bought my condo, I had to figure out how I would pay for new furniture because I didn't really have any money left.
rTO-BUY1AAPARTMENT6BI1THEN1AALSO1A*MONEY1A*FURNITURE4*
l
mkaufenwohnungdannauchgeldfür möbel
Hamburg | dgskorpus_hh_04 | 46-60m   When I bought it in 1998, I had to pay monthly installments.
r$NUM-TENS1:9*TO-BUY1ATHEN1AMONTH1TO-PAY3^
lI1
mkaufedannmonat
Hamburg | dgskorpus_hh_05 | 31-45m   They were divided among different host families and my mother and I hosted one of them.
rTHEN1ATO-DIVIDE5*I1MOTHER1*
l
mdann[MG]ichmutter
Hamburg | dgskorpus_hh_05 | 31-45m   So then I went on a seven month long trip through Asia with my girlfriend.
rTHEN1ATOGETHER3A^*BOYFRIEND-GIRLFRIEND1TOGETHER3A^*
l
mdannmit [MG][MG][MG]
Hamburg | dgskorpus_hh_05 | 31-45m   We stayed on Phuket for two or three days, then got on a ship and went to Phi Phi.
rTO-LET1^*$NAMETO-SWARM1^*THEN1ASHIP1AFTER2A*ARROW4^*
l
m[MG]phuket[MG]dannschiffnachphi {phi}
Hamburg | dgskorpus_hh_05 | 31-45m   I wanted to build something like that in Germany, but the problem was that you had to be a professional in your respective field to work at ITV.
rTHEN1A$GEST-OFF^HERE1*TO-TRY1
l
mdann[MG]hierversuchen
Hamburg | dgskorpus_hh_05 | 31-45m   Then I talked to Marco and got the script for my first play, “Argonautengang”.
rAND5I1TO-LOOK-AT1^THEN1A$NAME-MARCO1SELF1A*$INDEX1
l
mund[MG]marco
Hamburg | dgskorpus_hh_05 | 31-45m   Then they had this project called “Blue” at the institute [Whenever the informant mentions “the institute” he probably talks about the institute of German Sign Language at the University of Hamburg].
rTO-SLIDE-OR-TO-PUSH2^*THEN1ATO-POSTPONE3^PROJECT2A$INDEX1
l
mdannprojekt
Hamburg | dgskorpus_hh_07 | 18-30f   And what would the lessons look like?
rTHEN1AHOW-QUESTION-COMPARISON1*WHAT-DOES-IT-LOOK-LIKE1*TO-TEACH1
l
mdannwie sieht ausunter{richt}
Hamburg | dgskorpus_hh_07 | 18-30f   The deaf people would prefer to receive knowledge.
rTHEN1ADEAF1ANO1BGLADLY1
l
mgerne
Hamburg | dgskorpus_hh_07 | 18-30f   Then DGS was introduced, that was supposedly better than bilingual/
rTHEN1ATO-ALTER1DGS1BETTER2*
l
mdannd-g-sbesser
Hamburg | dgskorpus_hh_07 | 18-30f   Imagine working together later, at a bank, for example.
rTHEN1AMAYBE3*LATER3*$INDEX1
l
mdannvielleichtspäter
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   Did you continue school after you were done with the Realschule?
r$ALPHA1:R*SCHOOL1ATO-DISMISS1THEN1AWHAT-DOES-IT-LOOK-LIKE1TO-ROLL1A^*$GEST^
l
mrealschuleentlassenwie sieht aus
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   I continued school and I wanted to get my A-levels.
rTO-DISMISS1^THEN1AA-LEVEL1TO-JOIN1A^*I1
l
mdannabiturich
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   But I'd have the pratical side with the sports part.
rTHEN1A$LIST1:2of2dSPORTS1*PRACTICAL2
l
mdannsportpraktisch
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   He will graduate from High School soon.
rTHEN1AYEAR2AA-LEVEL1TO-WIND1^*
l
mdannjahrabitur
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   We are 24 years apart then.
rI1NEW4ASISTER1A*THEN1A$GEST-TO-PONDER1^$NUM-ONE-TO-TEN1A:4$NUM-TENS2A:2d*
l
m[MG]neuschwester[MG]vierundzwanzig
Köln (Cologne) | dgskorpus_koe_01 | 18-30f   It was a great surprise for me. I am really excited to meet my new sister when she arrives in November.
rI1LIKE6*GOOD1THEN1ANOVEMBER7I1TENSION2
l
mfür michwienovemberspannung
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   You can wear that for over ten years and it's still in style.
rTHEN1ATO-DEVELOP1AYEAR1B*EQUAL8*
l
mdann[MG]zehn jahre
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   And then everyone is able to communicate on the same level.
r$GEST-TO-STAY-CALM1^*THEN1ATO-LOOK-AT6^*$GEST-OFF^
l
mdann
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   But that’s not important, I’ve understood that in this context.
rI1*THEN1AIMPORTANT1*I1ALREADY1A
l
mwichtigschon
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Then, I/
rTHEN1AI1EQUAL8*
l
m
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Or I’ll pick up the others first, then you get on and then we’re off.
rGO-HOME1*TO-PACK2*DONE2*THEN1ATO-GO-OFF2^*TO-PICK-UP1*
lGO-HOME1*
mzu hause[MG]fertigdannab
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   And then we‘re off to Frankfurt to pick up #Name4.
rTHEN1ATO-DEPART2*I1*$PROD
l
mdann
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   We also had cheese and everything, even baloney.
rTHEN1A$PROD$GEST-OFF^*CHEESE2*
l
mkäse
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   If I needed something specific, I bought it there.
rNEED1SUDDENLY4^*NEED1THEN1ATO-BUY1A
lTO1
m[MG]bedarf[MG]hinkaufen
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   In the group I will adapt then and eat the noodles, too.
rMEANING1*TO-ADJUST1USUAL1NOODLES6
lTHEN1A
mbedeutanpassnorm{al}nu{del}
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   But if we take it from the freezer, we need to immediately freeze it again when we get there.

rTO-THROW1*COOL-OR-COLD2*REFRIGERATOR2*TO-FREEZE1*
lMUST1TO-BE-ON-THE-MOVE1THEN1ATO-THROW1
mmussunterwegsdannkühlschrankgefroren
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   We’ll cook it and take it with us of course.
rTHEN1AREFRIGERATOR2*ANYWAY1*
l$NUM-ONE-TO-TEN1B:1d*
msowieso
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   We’ll eat it up and then it’s checked off.
rOUTDOORS2^THEN1ALIKE6*DONE2*TO-TICK-OFF2
l
m[MG]
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   The next day, we’ll have spaghetti bolognese.
rTHEN1ADAY-AFTER-TOMORROW1B*$INDEX1*SPAGHETTI2*
l
mdannspa{ghetti}
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   We’ll get everything down on a list on Facebook.
r$ALPHA1:F*TO-THROW1^*MONTH1^THEN1A$INDEX1*
l
mfacebook
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Next time, you better pack those shorts with which you can get stuck in the snow.
rTHEN1AYOU1*SHORTS1^SNOW1
l
mschnee
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Sure, for the coming trip, we know how it works.
rCLEAR1ATHEN1AWHERE-TO1^*I1$GEST-NM-TO-SHRUG1^
l
mklar
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Well, then/
rREASON4B*THEN1A$INDEX1
l
m
Köln (Cologne) | dgskorpus_koe_08 | 31-45m   There’s sandpaper, round and long patches and some glue, as well.
rTO-GRATE-OR-TO-RUB2*THEN1AOR1*SQUARE2
lSQUARE2*ROUND6A*
m[MG]dannoder[MG]
Köln (Cologne) | dgskorpus_koe_09 | 18-30f   She died first, and I thought, “It is true, she is dead - there might be a connection between those events.”
rTHEN1A$INDEX1*VERY7*RELATIONSHIP2
l
mdann[MG]beziehung
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   After we won the German championships I went on a one-year break from training and used my seasonal ticket to watch the Dortmund team playing.
rOFF1AWORKOUT1*CARD1C*THEN1A$GEST-TO-PONDER1^
l
m[MG][MG]dann
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Then, I figured out that I was going to be a central defender, even though I’m usually a right winger. So, central defender, that was something to cope with.
rTHEN1ACLEAR1BI2IN-CONTAINED2*
l
mda{nn}klarichinnenverteidig
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Then, in the second half, #Duisburg put Name12 onto the field, as well as - what’s his name again - right, #Name11.
rTHEN1A$NUM-ORDINAL1:2$GEST-TO-PONDER1^DUISBURG2*
l
mzweite halbzeitduisburg
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Then/
rTHEN1A
l
mdann
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   What if it works out well? What happens then?
r$GEST-OFF^*GOOD1TO-RUN-MACHINE2THEN1A
l
mgutläuftwas dann
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   From this match on, those teams placing first and second will be sent to the semi-finals or directly to the finals.
rTHEN1AWHO3$NUM-ORDINAL1:1d*$NUM-ORDINAL1:2d*
l$INDEX1
m[MG]wererstezweite
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   For example, you guys come over here. Next, we’d have to drive a long way to another match on neutral grounds. That surely would be outrageous.
rYOU1*TO-DRIVE1*THEN1AI1OUTWARDS1*NEUTRAL1B
l
mdu[MG]dannich[MG]neutral
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   And the last time I participated in a race was in Denmark.
rTHEN1ALAST1ADENMARK1$GEST-OFF^*
l$INDEX1
mdannund letztedänemark
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   The Czechs filed for an objection claim.
rTHEN1APROTEST1^*REQUEST1BCZECH-REPUBLIC1
l
mdannantragtschechien
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   Then we took off. It was incredible.
rTHEN1AI2TAKE-OFF1B*VERY6*
l
m
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   Then we all got back onto the bus and drove off.
rTHEN1ATO-DRIVE1*BUS2TO-DRIVE1*
l
m
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   The booking worked out well and we flew there.
rIN-ADDITION1^*THEN1AI1AIRPLANE2A
l
m
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   And afterwards there was a march through the stadium.
rTHEN1ATO-MARCH1ROUND3A*
l
mdannmarsch marsch marsch
Köln (Cologne) | dgskorpus_koe_12 | NULLNULL   I was almost falling asleep by then.
rI2TO-FALL-ASLEEP1*THEN1A
l
m[MG]
Köln (Cologne) | dgskorpus_koe_13 | 61+m   The youth coach once organized a trip on a Saturday.
rAPPOINTMENT1A
lYOUNG2TO-GUIDE1BTHEN1AONCE1BSATURDAY1I2
mjugendleiterterminund danneinmalsamstag
Köln (Cologne) | dgskorpus_koe_13 | 61+m   Then one just says how one is doing and what’s going on.
rWHAT-ARE-YOU-DOING1
lWELL1THEN1AI1I1
m[MG][MG]was machen
Köln (Cologne) | dgskorpus_koe_13 | 61+m   I also train on Fridays but only for one hour.
rAND2A$GEST-DECLINE1^
lTHEN1AFRIDAY3BONLY2A
munddannfreitagauchnur
Köln (Cologne) | dgskorpus_koe_13 | 61+m   One plays skat one day, rummy the next.
rSIDE-OF-THE-BODY2*SKAT2OUTDOORS1A^*RUMMY1
l$NUM-ONE-TO-TEN1A:2THEN1A$INDEX1
mzweiseiteskatrommé
Köln (Cologne) | dgskorpus_koe_13 | 61+m   And then I did ninepin bowling.
rAND2A
lTHEN1ANINE-PIN-BOWLING1
mundkegeln
Köln (Cologne) | dgskorpus_koe_13 | 61+m   Most of the time we had a lot of fun.
r
lTHEN1AMOST1A$INDEX1MOOD3
mmeistensstimmung
Köln (Cologne) | dgskorpus_koe_13 | 61+m   I was supposed to fingerspell all the cities we passed while we were on the autobahn until I was able to do it correctly.
rTO-PRACTICE1
lTHEN1AI1$INDEX1
michübewas
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   They remodeled the mine and held some exhibitions. These showed the old mine workers with their black faces and the old houses from back then.
rTO-CLEAN3A*BIT2ATO-CLEAN3A*THEN1APICTURE1*PAST1^*SOURCE-TO-EMANATE1^*
l
mbisschengeputztbild
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   And then he saw that the people of this region were really religious.
rTHEN1ATO-SEE1MUST1WAS1*
l
mdannwar
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   You just said you would visit Cologne as well as Dortmund. Would you also go to Frankfurt and visit some sights?
rTO-DRIVE3*TO-BRING2B^*TO-VISIT1*THEN1AFRANKFURT1*ALSO3ATO-DRIVE3
l
m[MG]frankfurtauch
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   And then there is the chocolate museum.
rAND2A*THEN1ACHOCOLATE2*$ALPHA1:#$INDEX1
l
mundschokoladelindt
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   They said they definitely want to visit me again.
rGLADLY1*THEN1AONCE-AGAIN2BTO-VISIT-OR-TO-ATTEND1B*TO-COME-FROM1*
l
mgernnoch mal
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then I was stuck for a while, until I managed to get a job.
rTHEN1A$GEST-NM-SHAKE-HEAD1^$GEST-OFF^$GEST-NM-NOD-HEAD1^
l
mdannarb{eit}
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then, someone in Wuppertal heard that I was supposedly quite good at soccer.
rTHEN1ATO-LEARN-STH1B*WUPPERTAL2*$INDEX1
l
merf{ahren}wupper{tal}
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then/
rTHEN1ATHEN1A*
l
mdann
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then, there’s a particular dextrose.
rAND5THEN1A$ORAL^CERTAIN1*CERTAIN1*
l
mund[MG]dannb{estimmt}bestimmt
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then, the principal picked me up and brought me to the second grade classroom.
rTHEN1ASCHOOL1B*MAIN3^TO-PICK-UP1*
l
mdannschulleitunghol
Köln (Cologne) | dgskorpus_koe_17 | 61+f   When I was four years old I had meningitis.
rTHEN1A$NUM-ONE-TO-TEN1A:4OLD8B*END1^
l
mvierjahre alt
Köln (Cologne) | dgskorpus_koe_17 | 61+f   I had to be at our booth.
rTHEN1AI2$GEST-OFF^*I2
l
m
Köln (Cologne) | dgskorpus_koe_17 | 61+f   Then I started working.
rTHEN1A$GEST-OFF^PROFESSION6$GEST-OFF^
l
mdannberuf
Köln (Cologne) | dgskorpus_koe_17 | 61+f   I went to school then, to my classroom.
rTHEN1AI1IN1$GEST^
l
mund dannschule
Köln (Cologne) | dgskorpus_koe_17 | 61+f   We had to go to the other room first and then into our classroom.
rMUST1TO-GO-THERE1*TO-GO-THERE1*
lTHEN1A
mmussdann
Köln (Cologne) | dgskorpus_koe_17 | 61+f   So I stayed at my old job with my old boss.
rBOSS1BTO-STAY3I1*THEN1ATO-WORK2TO-STAY3*
l
mchefbleibenarbeitbleiben
Köln (Cologne) | dgskorpus_koe_17 | 61+f   Later, when he was older/
rTHEN1AI1*TO-SEE1
lCHILD2
mdann
Köln (Cologne) | dgskorpus_koe_17 | 61+f   I didn’t want my son to grow up by himself, so I started thinking about a second child.
rTHEN1A$NUM-ONE-TO-TEN1A:1dI1*
lPOOR-YOU1$GEST-OFF^*
meinarm[MG]
Köln (Cologne) | dgskorpus_koe_18 | 18-30f   He went to school in Hamburg.
rTHEN1ASCHOOL1AHAMBURG2*$INDEX1
l
mdannschulehamburg
Köln (Cologne) | dgskorpus_koe_18 | 18-30f   He grew up in Berlin and then moved to Hamburg to go to school there.
rBERLIN1A*TO-GROW-UP1A$INDEX1THEN1ATHERE1*SCHOOL1A*HAMBURG2*
l
mberlindannschulehamburg
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   The third one was in Munich, and the fourth one in Cologne, and then I went to Dresden again.
rTHEN1AMUNICH1A
l$NUM-ONE-TO-TEN1A:3d
mdannmünchen
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   We took a farewell photo, entered the airplane and then took off.
rTHEN1AAIRPLANE2C*FAR1
l
mdann[MG]
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   When we arrived, they started the audiograms, the pick up and so on. The competition started later on.
rTO-PICK-UP1*AND-SO-ON4*$GEST-OFF^THEN1AMATCH1*SOMETIME1^*
l
mabholen[MG]dannwettkampf[MG]
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   We'll see how the one in Erfurt will turn out.
rTHEN1AERFURT1TO-LOOK1$GEST^
l
merfurt
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   We arrived later, because it was only after school that we were able to leave for Berlin by train.
rSCHOOL1AFINISH1$INDEX1*THEN1ATO-GO-OFF1^LIKE4A^*$GEST^
l
mschulschlussdann[MG]
Leipzig | dgskorpus_lei_02 | 61+f   I left the TV running and came to know about the accident.
rFURTHER1ATO-LOOK-AT1*THEN1A$GEST^*ACCIDENT6*
l
mweiter[MG]unfall
Leipzig | dgskorpus_lei_03 | 18-30m   Not anymore, though. I switched to Schalke only.
rTHEN1A$ALPHA1:SCH-#-K-EI1
l
mschalke
Leipzig | dgskorpus_lei_03 | 18-30m   Will there soon be finals?
rTO-EXAMINE1TO-EXAMINE1
lTHEN1ASOON1
mprüfungprüfung
Leipzig | dgskorpus_lei_03 | 18-30m   And then, I think, in July/
rTHEN1A$ALPHA1:I
l
mdannjuli
Leipzig | dgskorpus_lei_03 | 18-30m   Afterwards I had a break of one or two month, and then the actual summer break began.
rFREE4*
lTHEN1AMONTH1*MONTH1*
mdannein monatzwei monatfrei
Leipzig | dgskorpus_lei_03 | 18-30m   Afterwards I had a break of one or two month, and then the actual summer break began.
rFREE4*HOLIDAYS1PERIOD-OF-TIME1A
lMONTH1*I1THEN1A
mzwei monatfreidannferien
Leipzig | dgskorpus_lei_03 | 18-30m   It‘s so weird now; we get two or three weeks off and then the final exams take place.
r$NUM-ONE-TO-TEN1A:2dWEEK2FREE4THEN1ATESTING-OR-INSPECTION1OUTDOORS1A^*PERIOD1C*
l
mzweiwochefreidannprüfung
Leipzig | dgskorpus_lei_03 | 18-30m   And on top of that, I had another two oral electives.
rTHEN1AMOUTH1A*
l$NUM-ONE-TO-TEN1A:2d$INDEX1
mdannzweimündlich
Leipzig | dgskorpus_lei_03 | 18-30m   You‘ll be done in four months time.
rTHEN1AMONTH1*TO-BE-RID-OF1*$GEST-OFF^
l
m[MG]vier monatlos
Leipzig | dgskorpus_lei_03 | 18-30m   And then you‘re going to do your presentation on it?
r$GEST-OFF^
lTHEN1ALECTURE1THEN1A*
mdann[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   Yes, later on. I‘m going to present on April 24th.
rTHEN1A$NUM-ONE-TO-TEN1B:4$NUM-TENS2A:2dAPRIL6
l
mdannvierundzwanzigsterapril
Leipzig | dgskorpus_lei_03 | 18-30m   Yes, I‘ll only talk for a bit, and I‘ll hand in the book, as well.
rSELF1ATO-TELL1*TO-COMPRESS1A^THEN1ABOOK1BMEASURE-VERTICAL2A^
l$INDEX1
mselbsterzählekurzaberbuch[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   Afterwards, you entered the Realschule.
r
lTHEN1AMIDDLE-SCHOOL1
mdannreal
Leipzig | dgskorpus_lei_03 | 18-30m   If you were to fail, you wouldn‘t have any school-leaving qualification, would you?
rTO-FALL-THROUGH1TO-SHOW-PAPER2$GEST-OFF^
lYOU1THEN1ANONE1
mdudurchfallendannkein
Leipzig | dgskorpus_lei_03 | 18-30m   I‘m not sure when I‘ll do it, maybe in August.
rI1NEXT1THEN1AWHEN2NEXT1*$GEST-I-DONT-KNOW1^
l
mdannwann[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   I told them that I‘d like to take driving lessons and then signed up for those.
rTO-STEER-STEERING-WHEEL1^*
lTHEN1AI1TO-LET-KNOW1A
m[MG]fahrschule
Leipzig | dgskorpus_lei_03 | 18-30m   I didn‘t make it the first time, but I passed my driving test second time around.
r$GEST-DECLINE1^TO-PASS-OR-TO-PERSIST1DONE4
lFIRST-OF-ALL1ADONT-ACCOMPLISH1*THEN1A
mersteschaff nichtdannbestanden[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   I was able to continue with my driving lesson there, and I wanted to take my driving test, as well.
rTO-GIVE-HOLD-ON-TO1A*TO-LINK1A^FURTHER1A*
lTHEN1AI1
mdann[MG]weiter
Leipzig | dgskorpus_lei_03 | 18-30m   I was able to continue with my driving lesson there, and I wanted to take my driving test, as well.
rTO-LINK1A^FURTHER1A*CAR-DRIVING2*TO-EXAMINE1$GEST-OFF^
lTHEN1A
m[MG]weiterfahrendannprüfung[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   I sent my documents to the Dekra [Deutscher Kraftfahrzeug-Überwachungs-Verein, English lit.: German Motor Vehicle Inspection Association] for them to check them and inform the driving school in Weimar about everything.
rDOCUMENTS-OR-PAD1*TO-STEER-STEERING-WHEEL1^
lTHEN1AI1
m[MG]fahrschule
Leipzig | dgskorpus_lei_03 | 18-30m   I sent my documents to the Dekra [Deutscher Kraftfahrzeug-Überwachungs-Verein, English lit.: German Motor Vehicle Inspection Association] for them to check them and inform the driving school in Weimar about everything.
r$$EXTRA-LING-ACT^
l$INDEX1TO-SEND-OR-TO-DISPATCH2*THEN1ATO-GIVE1*
mbriefdann
Leipzig | dgskorpus_lei_03 | 18-30m   After those arrived, I was allowed to drive.
rTO-OPEN-BOOK1^*
lPRESENT-OR-HERE1THEN1AI1ALLOWED5*I2
mdadanndarf
Leipzig | dgskorpus_lei_03 | 18-30m   We take turns.
rTO-PLAY2*TO-PLAY2ALTERNATION1
l$INDEX1THEN1AI1
mich[MG]
Leipzig | dgskorpus_lei_03 | 18-30m   Next time around, they are going to take place in Greece in 2013.
r
lTHEN1A$NUM-THOUSANDS1:2d$NUM-TEEN1:3d$INDEX1
mzweitausenddreizehn
Leipzig | dgskorpus_lei_04 | 46-60m   I then did the application/
rTHEN1ATHEN1C*I1REQUEST1B*
l
mdann
Leipzig | dgskorpus_lei_04 | 46-60m   Well, after that, I worked.
rTHEN1C*THEN1ATO-WORK2TO-DEVELOP1A$GEST-OFF^
l
mdannarbeit
Leipzig | dgskorpus_lei_05 | 61+f   He did that every time, just like a dog.
rTHEN1AALWAYS5LIKE-THIS1A$GEST-OFF^
l
mimmer immer[MG]
Leipzig | dgskorpus_lei_09 | 31-45f   Then I went back home.
rTHEN1AAT-HOME2
l
mdannzu hause
Leipzig | dgskorpus_lei_11 | 31-45f   At school, the lessons were held only orally, too.
rTHEN1ASCHOOL1ACLEAR1A*TO-TEACH1
l
mdannschuleklarunterricht
Leipzig | dgskorpus_lei_11 | 31-45f   I then started studying in Dresden.
rTHEN1ADRESDEN1$INDEX1TO-STUDY1
l
mdanndresdenstudium
Leipzig | dgskorpus_lei_11 | 31-45f   If we had goose one year, we are having duck the next.
rNOT3AAFTERWARDS1A^GOOSE2THEN1ADUCK2TO-SWAP3A*
l
mein jahrgansente
Leipzig | dgskorpus_lei_11 | 31-45f   They usually have pork at the house of my husband’s family in Brandenburg.
rTHEN1A$INDEX1MY1HUSBAND1
l
mmann
Leipzig | dgskorpus_lei_11 | 31-45f   He took another one which was also filled with mustard!
r$PRODTHEN1A$NUM-ORDINAL2:2d$PRODSAME5
l
mzweite[MG]selbe
Leipzig | dgskorpus_lei_12 | 61+m   And that‘s how I came to do the three years of apprenticeship in Leipzig.
rTHEN1ATHROUGH2B$INDEX1EDUCATION1*
l
mdanndurchausbildung
Leipzig | dgskorpus_lei_12 | 61+m   At first, well, it started off with the “Jugendweihe” and afterwards we had the confirmation.
rYOUNG2^BLURRY1A^$INDEX1THEN1A$NUM-ORDINAL1:2d$INDEX1CATHOLIC1C^
l
mjugendweihedannzweitekonfirmation
Leipzig | dgskorpus_lei_12 | 61+m   My granddaughter/
rTHEN1AGRANDCHILD3*
l
mdanne{nkel}
Leipzig | dgskorpus_lei_12 | 61+m   If I miss something, I just communicate in writing.
rNOT6*TO-COMPREHEND1^I1THEN1AWRITTEN1B
l
mnichtschriftlich
Leipzig | dgskorpus_lei_13 | 46-60m   Right after we had passed the border, the signal lamp started to flash again. I thought, “Oh yeah, right. That's what the mechanic told us.”
r$INDEX1*$PRODTO-STEER-STEERING-WHEEL1^*THEN1ASOURCE-TO-EMANATE1^*RIGHT-OR-AGREED1ATO-LET-KNOW1A*
l
mrotach stimmt
Leipzig | dgskorpus_lei_14 | 31-45m   He resigns and immediately, his kidneys hurt.
rTO-DROP-OR-TO-GIVE-UP8THEN1ALOWER-BACK1D
l
mab[MG][MG]
Leipzig | dgskorpus_lei_14 | 31-45m   But did you see the reporter afterwards?
rBUT1THEN1A$INDEX1REPORTER1IN1
l
maberdannreportin
Leipzig | dgskorpus_lei_14 | 31-45m   But after that, there were no other fights for him.
rBUT1*THEN1ATO-BOX1$GEST-OFF^
l
m
Leipzig | dgskorpus_lei_14 | 31-45m   And then Chisora started firing against him and he beat him up, oh well.
rTHEN1A$ALPHA1:CTO-CRITICISE1A*TO-CRITICISE1B*
l
mchis{or}a[MG]
Leipzig | dgskorpus_lei_14 | 31-45m   Then we’ll know.
rTO-SEE1*THEN1ATO-SEE1*$GEST-OFF^*
l
msehendannsehen
Leipzig | dgskorpus_lei_14 | 31-45m   I went to bed and slept. That’s it.
rBED1B*BED1BRIGHT-OR-CORRECT1B*
lI1THEN1A
m[MG]richtig
Leipzig | dgskorpus_lei_14 | 31-45m   So I got up and came here by train, really relaxed.
rTHEN1ATO-GET-UP1TO-SWARM1^BODY1^*
l$GEST-OFF^
mauf[MG]
Leipzig | dgskorpus_lei_14 | 31-45m   Well, the newspaper paid for the flight/
r$INDEX1$ALPHA1:B-I-L$INDEX1THEN1ATO-PAY1AIRPLANE2CAIM2^
l
mbildbezahl daflugzeug
Leipzig | dgskorpus_lei_15 | 18-30f   There were many different subjects.
r$INDEX1THEN1A$INDEX1$GEST-OFF^MUCH-OR-MANY1A
l
mdann
Leipzig | dgskorpus_lei_15 | 18-30f   Or did people speak and were interpreted?
rOR4B*$INDEX1TO-SPEAK6THEN1AINTERPRETER1TO-APPOINT-SB1A$GEST-OFF^
l
moder[MG]dolmetscher
Leipzig | dgskorpus_lei_15 | 18-30f   I was worried about what we would do upon leaving Belgium.
rMUSCLE5^*TO-SWARM1^*TO-LEAVE1A*THEN1A$PROD
l
mbelgienverlassendann
Leipzig | dgskorpus_lei_15 | 18-30f   Then there also was about one/
r$INDEX1THEN1AALSO1ABEEN1*$NUM-ONE-TO-TEN1A:1d
l
mdannauchgewesenein
Leipzig | dgskorpus_lei_15 | 18-30f   I think we met up at the trade fair and started marching.
rAND2B*THEN1AMASS-OF-PEOPLE-ACTIVE8*
l
mund[MG]
Leipzig | dgskorpus_lei_15 | 18-30f   I found out later that the connection worked out well, but one or two days later it was closed with no chance to get to the train station.
rTHEN1A$ORAL^$NUM-ONE-TO-TEN1A:1$NUM-ONE-TO-TEN1A:2
l
mdannglaubeeinzwei
Leipzig | dgskorpus_lei_15 | 18-30f   At the end of the demonstration, they stated their demands.
rTHEN1CMASS-OF-PEOPLE-ACTIVE8^*DONE1ATHEN1ADEMONSTRATION3
l
mdemo[MG]dann
Leipzig | dgskorpus_lei_15 | 18-30f   And then/ Right, the crowd had broken up.
rTHEN1ATHERE1EVENING2*RIGHT-OR-AGREED1A*
l
mund dannstimmt
Leipzig | dgskorpus_lei_15 | 18-30f   We met again at the gala evening.
rTHEN1AEVENING2THERE1TO-MEET1
l
mund dannabenddatreffpunkt
Leipzig | dgskorpus_lei_15 | 18-30f   Then the Türkisparade took place the next day and then/
rAND2A*THEN1APLANT1^*DEMONSTRATION3*TURQUOISE2B
l
mdannfrühtürkis{parade}türkis
Leipzig | dgskorpus_lei_15 | 18-30f   Then the Türkisparade took place the next day and then/
rDEMONSTRATION3*TURQUOISE2BDEMONSTRATION3*THEN1A
l
mtürkis{parade}türkisparadedann
Leipzig | dgskorpus_lei_15 | 18-30f   And in the afternoon, the Sign Language Festival was opened.
rTHEN1ASIGN-LANGUAGE1BFESTIVAL2ABEGINNING1A
l
mdanngebärdensprachfestivalanfangen
Leipzig | dgskorpus_lei_15 | 18-30f   No, well, I remember rushing to Berlin that Friday and I made it just in time.
rSTILL5*I1FAST3A*THEN1AI1TO-ACCOMPLISH1A
l
mnoch[MG]schaffen
Leipzig | dgskorpus_lei_15 | 18-30f   It was a half hour performance.
rTHEN1A$INDEX1LIKE4A$INDEX1
l
mund dannso wie
Leipzig | dgskorpus_lei_15 | 18-30f   Well, the play had started already.
rBEGINNING1A*$GEST-OFF^TO-DEVELOP2THEN1A
l
manfang[MG]
Leipzig | dgskorpus_lei_15 | 18-30f   The next day the ”Türkisparade” [turquois parade] took place, I think, yes, the Türkisparade.
rTHEN1ANEXT1DAY1ATO-BELIEVE2A
l
mnächstetagglaube
Leipzig | dgskorpus_lei_15 | 18-30f   In the afternoon and in the evening, the sign language and poetry contest took place.
rTHEN1AAFTERNOON3OR4A*EVENING2
l
mdannnachmittagoderabend
Leipzig | dgskorpus_lei_15 | 18-30f   And then the awards ceremony.
rTHEN1AREWARD3CLEAR1B*TO-HONOUR1A*
l
mund dannpreis
Münster | dgskorpus_mst_01 | 46-60m   A few years after, I wasn't a member of the theatre group anymore, because I was pregnant.
rTHEN1ATO-DEVELOP2SOME1LATER5
l
m[MG]paarjahre später
Münster | dgskorpus_mst_01 | 46-60m   Was that sad for you?
rYOU1*THEN1ASAD1*$GEST-OFF^*
l
mdudanntrau{rig}
Münster | dgskorpus_mst_01 | 46-60m   Now, little by little, they close some.
rSLOW1*$INDEX1CLOSED1B
lTHEN1A
mlangsam[MG]dann
Münster | dgskorpus_mst_02 | 18-30f   They used to happily sign GREEN like that, now they changed it to that.
rPAST-OR-BACK-THEN1*GREEN49A*THEN1ATO-SWAP3AGREEN2*
l
mfrühergrün gründanngrün
Münster | dgskorpus_mst_02 | 18-30f   In the evening, we’d take it slow, sit down at a restaurant. I’d show her what you can see where.
rTHEN1AEVENING2$GEST-TO-STAY-CALM1^*$INDEX1*
l
mdannab{ends}[MG]
Münster | dgskorpus_mst_02 | 18-30f   Then/
rTHEN1A
l
mdann
Münster | dgskorpus_mst_03 | 18-30f   I went to school growing up, went back home for about three or four years, and then I moved to a city.
rTHEN1AI2SCHOOL1ATO-SWARM1*
l
mschule
Münster | dgskorpus_mst_03 | 18-30f   I went to school growing up, went back home for about three or four years, and then I moved to a city.
rYEAR1A*FINISH1DONE2*THEN1AI1CITY2TO-MOVE1*
l
mvier jahredannstadt
Münster | dgskorpus_mst_03 | 18-30f   When I was ten, we moved to Germany.
rTHEN1AI1$NUM-ONE-TO-TEN1D:10OLD5A
l
mdannichzehnjahre
Münster | dgskorpus_mst_03 | 18-30f   Nevertheless, it was a sad experience for me. Yet, school was all over soon after that, anyways.
rPROCEEDING2^WHATEVER3*PROCEEDING2^THEN1ASCHOOL1AOFF1A*
l
megaldannschule
Münster | dgskorpus_mst_03 | 18-30f   At some point, I was done with school in Dortmund. Afterwards, I went to Essen to complete my apprenticeship within four years.
rTHEN1AI1$GEST-OFF^*DORTMUND1*
l
mdortmund
Münster | dgskorpus_mst_03 | 18-30f   Last year I got a sudden hearing loss in my left ear. Now I am deaf in one ear.
rTHEN1ALAST5YEAR1AI1
l
mdannletztesjahr
Münster | dgskorpus_mst_03 | 18-30f   Then off to another place after a few days, I would like that.
rTHEN1ASOME1LATER10*FURTHER1A
l
mdannpaar tagespäterweiter
Münster | dgskorpus_mst_03 | 18-30f   You have more time when you are thirty or almost thirty, it is a good age. I don‘t mind it.
rI2*$NUM-TENS1:3dBETWEEN1D*THEN1AAPPROXIMATELY1$NUM-TENS1:3dTO-POSTPONE3^
l
mmitdreißigungefährdreißig
Münster | dgskorpus_mst_04 | 31-45m   After finishing school in the GDR, deaf people would immediately get a job.
rGDR4PERSON1*SCHOOL1ATHEN1ATO-DISMISS1TO-WORK2TO-OBTAIN1*
l
md-d-rschuledannentlassenarbeitbekomm bekomm {be}komm
Münster | dgskorpus_mst_04 | 31-45m   When deaf people have to go look for a new job, it’s a lot more difficult nowadays.
r$INDEX1THEN1ATODAY3TIME1NOW3*
l
m[MG]dannheut{igen}z{eit}
Münster | dgskorpus_mst_06 | 31-45m   And you managed that?
rHOW-QUESTION-COMPARISON1*TO-ACCOMPLISH1C*
lTHEN1A$INDEX1
mdannschaff
Münster | dgskorpus_mst_06 | 31-45m   The fresh oil still has to be poured in.
rFRESH1
lTHEN1A$ALPHA1:O-LOIL1
mnochölfrischöl
Münster | dgskorpus_mst_06 | 31-45m   The monsoon season, right.
rQUARTER3*
lTHEN1ARAIN1A*YEAR1A^*
mregenzeit
Münster | dgskorpus_mst_06 | 31-45m   When I got home my grandma said to me, “You’ve got a bad sunburn.“
rTO-RETURN1*LIKE1*BURN1
lTHEN1AGRANDMA1C
mzurückomaverbrannt
Münster | dgskorpus_mst_06 | 31-45m   When I got up I cooled everything down.
rCAN2A
lATTENTION1A^*THEN1ATO-GET-UP1*I2
mkannauf{stehen}
Münster | dgskorpus_mst_06 | 31-45m   Ever since that experience it’s been carved into my head: You have to use sunscreen, especially at the sea.
rDONE4
lTHEN1AI1TO-THINK1B
m
Münster | dgskorpus_mst_08 | 61+f   I was shocked when he was shot.
rTO-HIT1^*TO-SHOOT1D*I1*SHOCK2B*
lTHEN1A$GEST^
mschock
Münster | dgskorpus_mst_08 | 61+f   So they shot him from top of the tower building.
rTHEN1ATO-SEND-OR-TO-DISPATCH1^TO-SHOOT1D*ABOVE1*
l
m[MG]schießenoben
Münster | dgskorpus_mst_09 | 31-45f   But you could definitely ask your co-workers first if they thought you would get some time off work if you started at a new work place, or with new tasks, or did some volunteer work.
rFREE1*TO-GIVE1*YES1ATHEN1A
l
mfreigebenjadann
Münster | dgskorpus_mst_10 | 46-60f   My husband and I wanted to get married and there were so many laws.
rTOGETHER3A^*TO-MARRY3BI1*THEN1AMUST1*STATUTE1A
l
mheiratenichmuss
Münster | dgskorpus_mst_11 | 61+m   In any case, that day was in the year 1943, no, ‘45, around March.
rTHEN1A$NUM-TEEN2A:9d*$NUM-HUNDREDS1*$NUM-ONE-TO-TEN1A:3d
l
mneunzehnhundertdrei v{ier}
Münster | dgskorpus_mst_11 | 61+m   But I had some classmates whose houses were destroyed by bombs.
r$INDEX1
lTHEN1ASCHOOL3LATER3$INDEX1
mdannschüler
Münster | dgskorpus_mst_11 | 61+m   After school finished, we walked back home together again.
rDONE1A*FINISH1THEN1ABY-FOOT1A*TO-GO-THERE1
l
m[MG]schlusszu fuß
Münster | dgskorpus_mst_12 | 31-45m   Because of the forthcoming election, they wanted to brag and show people they can trust politicians.
rBIT2ATO-SHOW1ATO-SHOW-OFF1*THEN1AELECTION1A*TRUST1$GEST-OFF^
l
mbisschenangebenwahlvertrauen
Münster | dgskorpus_mst_13 | 46-60f   When they had landed, it was like/
r$PRODDONE1AI1*THEN1AI2*LIKE4A*
l
mfertigichdannfür mich
Münster | dgskorpus_mst_13 | 46-60f   When I was five and a half years old and was almost ready for school, I was slowly prepared for it.
rTHEN1A$NUM-ONE-TO-TEN1A:5HALF6*SOON3*
l
mdannfünfeineinhalbbald
Münster | dgskorpus_mst_13 | 46-60f   Nevertheless, I was the best in class among all the other hearing people.
rTHEN1AI1CLASS2*BETTER1*
l
mund dannklassebesser
Münster | dgskorpus_mst_15 | 31-45f   After a while, she informed me about the first meeting, to which I then went.
rTHEN1ATO-DEVELOP1B*TO-LET-KNOW1A*$INDEX1*
l
mdann[MG][MG][MG]
Münster | dgskorpus_mst_15 | 31-45f   Then, they handed me the lyrics to take them with me. At home, I pondered on how to transfer it into sign language. Afterwards, I practiced it, as well.
rTHEN1ATO-GIVE1*I1*AT-HOME1B
l
mdann[MG][MG]zu hause
Münster | dgskorpus_mst_15 | 31-45f   I received lots of positive feedback after the event. People told me how much they appreciated the combination of signs and music.
rTHEN1AFEEDBACK1*TO-LET-KNOW1A*VERY6*
l
mdannrückmeldung[MG]
Münster | dgskorpus_mst_15 | 31-45f   Yet, I was lucky that #Name2‘s husband was a member of the church council.
rTHEN1A$INDEX1I1MY1*
l
mdannglück
Münster | dgskorpus_mst_15 | 31-45f   They told me as well that the assignment of interpreters had already been confirmed.
rTHEN1A$INDEX1*FOR1TO-LET-KNOW1A*
l
mdann[MG][MG]
Münster | dgskorpus_mst_15 | 31-45f   How did you feel when all eyes were upon you?
rYOU1THEN1ASELF1A*RESULT1*TO-LOOK-AWAY-AND-BACK1*
l
mdannselbstergebins
Münster | dgskorpus_mst_16 | 61+m   Then I went to the day care and saw everyone talking.
rTHEN1ACHILD2*TO-GO-THERE1I1
l
mdannkindergarten
Münster | dgskorpus_mst_16 | 61+m   Then/ He then asked me, “How old are you?“
rTHEN1A$INDEX1THEN1AOLD2C
l
mdann[LM:ah]dannwie alt
Münster | dgskorpus_mst_16 | 61+m   Then/ He then asked me, “How old are you?“
rTHEN1A$INDEX1THEN1AOLD2C
l
mdann[LM:ah]dannwie alt
Münster | dgskorpus_mst_16 | 61+m   Then, the foster mother came and said to my mother, “Just leave him.“
rTHEN1A$ORAL^$INDEX1$INDEX1
l
mdannkommt
Münster | dgskorpus_mst_16 | 61+m   I moved to Dortmund where my vocational school was located.
r$INDEX1TO-COME-FROM1*THEN1ATO-GO-THERE1*DORTMUND1*PROFESSION7
l
m[MG]kommennachdortmundberufsschule
Münster | dgskorpus_mst_16 | 61+m   The examination took two days and included a practical part. Suddenly, it was done.
rDAY3*TESTING-OR-INSPECTION1*THEN8THEN1APRACTICAL2DONE4$GEST-OFF^
l
mtagprüfungdannpraktisch[MG][MG]
Münster | dgskorpus_mst_16 | 61+m   Finally, I rang the bell, and my mother opened the door and looked down the staircase.
rI1TO-RING-DOORBELL1*THEN1AMOTHER5*TO-OPEN1B*$INDEX1
l
m[MG]schellenmutter
München (Munich) | dgskorpus_mue_01 | 61+f   From the 12th of August I have a diverse program.
rTHEN1A$NUM-SNIP1:2AUGUST6*I1
l
mzwölfaugust
München (Munich) | dgskorpus_mue_02 | 31-45m   It was really exciting to watch all the different plays.
rI2FASCINATING2TO-WATCH1^*THEN1A$GEST-OFF^
l
mdann
München (Munich) | dgskorpus_mue_02 | 31-45m   It used to be a horse race, back when we still had a king.
rHORSE5TO-RUN-OR-TO-RACE3AMONG-EACH-OTHER1^THEN1A$GEST-OFF^
l
mpferderennen
München (Munich) | dgskorpus_mue_02 | 31-45m   In the beginning you drink a couple of beers until you are drunk and then you jump around and scream.
r$GEST-TO-STAY-CALM1^TALK2BINTOXICATED2THEN1ATO-HOP-LEG1A^*TO-BARK3^*TO-CELEBRATE1
l
m[MG]unterhaltendann[MG]
München (Munich) | dgskorpus_mue_03 | 46-60m   Then I received an email.
rTHEN1A$NUM-ONE-TO-TEN1A:1dI1$GEST-TO-PONDER1^
l
mdanneinich
München (Munich) | dgskorpus_mue_03 | 46-60m   When I was born, I had an illness, and my parents didn’t know what to do.
rTHEN1A$GEST^AND2A*PRESENT-OR-HERE1*
l
mda
München (Munich) | dgskorpus_mue_03 | 46-60m   It was a home birth, in #196X on top of that, so/
rBIRTH1B*$GEST-OFF^END1^*THEN1A$GEST^
l
m[MG][MG]
München (Munich) | dgskorpus_mue_03 | 46-60m   Then, one deaf guy asked if we knew Gunter Trube.
rTHEN1ALATER2$NUM-ONE-TO-TEN1A:1dDEAF1A*
l
meingehörlos
München (Munich) | dgskorpus_mue_03 | 46-60m   Then, I started going to school in Straubing.
rTHEN1AI2STRAUBING1A*SCHOOL9
l
mdannichstraubingschule
München (Munich) | dgskorpus_mue_03 | 46-60m   We took different trips during the day and in the evening after diner, Gunter Trube performed.
rEVENING2*TO-EAT-OR-FOOD1DONE1BTHEN1A$ALPHA1:G*$ALPHA1:TTO-STAND1A^*
l
mabendessenfertigdanngunter trubeauftritt
München (Munich) | dgskorpus_mue_03 | 46-60m   Then they had a funeral and, how can I put this, a memo/
rTHEN1ASUDDENLY4^*FUNERAL1AND2A
l
mdannbeerdigungund
München (Munich) | dgskorpus_mue_03 | 46-60m   I did my apprenticeship close to Munich.
rTHEN1A*$GEST^THEN1AI1TO-LEARN2A^TO-GO-THERE1
l
mausbildung
München (Munich) | dgskorpus_mue_03 | 46-60m   At first, I was in the deaf sports club and had my friends there, but later I joined the deaf club.
rCLUB-OR-SOCIETY2A*TO-JOIN1A^*CONTACT1*THEN1ALATER2DEAF1B*CLUB-OR-SOCIETY2A*
l
mvereineinkontaktdannspätergehörlosenverein
München (Munich) | dgskorpus_mue_03 | 46-60m   Then, they had this special broadcast specifically on the topic that I watched as well.
rTHEN1ASPECIAL1*$INDEX1$ALPHA1:B
l
mdannspeziellspe{ziell}brennpunkt
München (Munich) | dgskorpus_mue_03 | 46-60m   When Pope John Paul died a little while later, I was wondering who would become the next pope.
rTHEN1ALATER2*$ALPHA1:J$NUM-ORDINAL1:2d
l
mdannspäterpapstjohannes paul
München (Munich) | dgskorpus_mue_03 | 46-60m   I was really excited to see what would happen.
rTHEN1AI1$CUED-SPEECH*TENSION4A*
l
mund dannichbingespannt
München (Munich) | dgskorpus_mue_03 | 46-60m   After my birth they discovered that I couldn’t hear anything.
rTHEN1ATHEN1A*$GEST-OFF^TO-SMOKE1A^*
l
mdanndann
München (Munich) | dgskorpus_mue_03 | 46-60m   Sunday night, we flew in.
rTHEN1AWE1B*WAS1*SUNDAY2
l
mdannwirwaram sonntagabend
München (Munich) | dgskorpus_mue_03 | 46-60m   The two of us decided we wanted to get in contact with Josef Rothkopf.
rTRADE-OR-NEGOTIATION2^*THEN1ACONTACT1DONE1B
l
m[MG]kontakt[MG]
München (Munich) | dgskorpus_mue_03 | 46-60m   We also celebrated together with the church.
rTHEN1AALSO3A*CHURCH2ATOGETHER3A*
l
mdannauchkirchezusammen
München (Munich) | dgskorpus_mue_03 | 46-60m   Then, everyone was free to spend their afternoon as they pleased in the city.
rTHEN1ALATER2AFTER1*LUNCH-OR-NOON4*
l
mdannspäternachmittag
München (Munich) | dgskorpus_mue_04 | 18-30f   If my budget allows it, I can go on vacation, too.
rEYE1^*MONEY1A*RIGHT-OR-AGREED1A*THEN1AAIRPLANE2C*CAN1*$GEST-OFF^*
l
m[MG]stimm stimmdannkann
München (Munich) | dgskorpus_mue_04 | 18-30f   We discuss the amount of days that we want to rent the car for and make the most of them. So, we visit different sights on those days.
rHOW-MUCH5*DAY1B*TO-DIVIDE-IN1A^*THEN1A$INDEX1CAR-DRIVING2$PROD
lSHELF2A^*
mwie vieltagendannauto[MG]
München (Munich) | dgskorpus_mue_04 | 18-30f   You are able to walk from the hotels to Disneyland.
rTHEN1AROUND4A^LOCATION1A^*AFTERWARDS1A^
l
mdannhotel
München (Munich) | dgskorpus_mue_04 | 18-30f   If you continue walking, you'll walk past the Disney Studios and right next to those are the different rides.
rTHEN1AFURTHER1A*TO-GO2A*THERE-IS3*
l
mweitergibt
München (Munich) | dgskorpus_mue_04 | 18-30f   There are five different themes throughout the park.
rTHEN1AALSO1A$NUM-ONE-TO-TEN1A:5STYLE2*
l
mdannauchfünfstil
München (Munich) | dgskorpus_mue_04 | 18-30f   Everything is very thoroughly explained in the Disney Studios in the very beginning though.
rTHEN1AROUND-THE-CORNER1^*BEFORE1AROUND-THE-CORNER1^
l
mdannvorher
München (Munich) | dgskorpus_mue_04 | 18-30f   I made my way from the North of Japan towards the South.
rTHEN1AFROM-OR-BY-OR-OF3*NORTH1BUNTIL1*
l
mvonnordbis
München (Munich) | dgskorpus_mue_04 | 18-30f   So the vacation in the Dominican Republic/
rTO-SAY2B*$ALPHA1:D-RTHEN1ANEXT-TO1A$GEST-OFF^*
l$NUM-ONE-TO-TEN1A:1d$LIST1:2of2d*$NUM-ONE-TO-TEN1A:2d
msag maldominikanische republik
München (Munich) | dgskorpus_mue_04 | 18-30f   If you have a late breakfast, you don't need lunch and then you can have an early dinner, and you are still able to go out and do something afterwards.
rLATE3A*BREAKFAST1*THEN1ALUNCH-OR-NOON3*AROUND-THE-CLOCK7^*
lAROUND-THE-CLOCK6^*AROUND-THE-CLOCK1^*AROUND-THE-CLOCK1^*LUNCH-OR-NOON5*
mspätfrühstückdannmittag
München (Munich) | dgskorpus_mue_04 | 18-30f   That'll only work when I have enough money.
rMONEY1ARIGHT-OR-AGREED1B*CLEAR1A*THEN1ADIVERSITY1*
l
mgeldstimmt stimmtklardann
München (Munich) | dgskorpus_mue_06 | 18-30f   There was a discussion about different hearing aids.
rI2BEEN1DISCUSSION1ATHEN1ATO-HEAR2*QUOTATION-MARKS1*TO-HEAR2
l
mgewesendiskussiondannhörhörhilfe
München (Munich) | dgskorpus_mue_07 | 18-30m   The group was a rather international one with people from Australia, Sweden, the Netherlands and even some from Germany.
rFRANCE2I2*TO-SWARM1THEN1A$INDEX1
l
m[MG]
München (Munich) | dgskorpus_mue_07 | 18-30m   In the evening the travel guide explained what the group would do the next day.
rTOMORROW1BTO-MAKE1$INDEX1*THEN1A
l
mmorgenwas machen
München (Munich) | dgskorpus_mue_07 | 18-30m   I didn‘t get it, since I didn't see a problem.
rI1$GEST-NM^THEN1AI1CARELESS3A^*I1*
l
m[MG]
München (Munich) | dgskorpus_mue_07 | 18-30m   When the guide finished his explanations to the group, I talked to him separately again and he again explained the plan for the next day to me.
rINFORMATION2B*TO-SIGN4^*DONE1BTHEN1AI1INTEREST1A*TO-DISCUSS1*
l
mfertigdannerklären
München (Munich) | dgskorpus_mue_07 | 18-30m   An hour on deafness, then an hour on being blind and so on. That would be very great.
rSUBJECT1*SUBJECT1*DEAF1A*THEN1ASUBJECT1*HOUR2B*SUBJECT1*
l
mthemada{nn}eine stundethema
München (Munich) | dgskorpus_mue_07 | 18-30m   An hour on deafness, then an hour on being blind and so on. That would be very great.
rHOUR2B*SUBJECT1*BLIND1A*THEN1AHOUR2B*SUBJECT1*TO-SWAP3A*
l
meine stundethemablindeine stundethemawäre
München (Munich) | dgskorpus_mue_07 | 18-30m   When they’re done, they go to the Oktoberfest together and go to their respective tents.
r$INDEX1MASS-OF-PEOPLE-ACTIVE5*$PRODBEER3*LOCATION1A^*$PROD
lTHEN1A
malle[MG][MG]dannbierzelt[MG]
München (Munich) | dgskorpus_mue_08 | 18-30f   Always being afraid of what other countries might say about it, that it might start another war or whatever.
rIMAGINATION1A*THEN1AWHAT1A*TO-SAY1*DIFFERENT2*
l
mvorstellendannwassagenandere
München (Munich) | dgskorpus_mue_08 | 18-30f   And then we returned the TV the week after.
rTHEN1ANEXT1WEEK2ONCE-MORE1A*
l
mdanndannwieder
München (Munich) | dgskorpus_mue_08 | 18-30f   If I imagine I would have lived during the war and the post-war years where everyone maligned Germany.
rIMAGINATION1A*WITH1ATO-LIVE4THEN1AAFTERWARDS2A*AFTER1TO-SHOOT1B^*
l
mvorstellenmiterlebtdanndanachnachkriegszeit
München (Munich) | dgskorpus_mue_09 | 61+f   What I still find interesting to this day:
rUNTIL1THEN1AINTEREST1A*$GEST^$INDEX1
l
mbisdann[MG]
München (Munich) | dgskorpus_mue_09 | 61+f   Then I read this really interesting book. What's its name again? “Love is a phenomenon” or something like that.
rTHEN1AI1BOOK1BINTEREST1A
l
mbuch[MG]
München (Munich) | dgskorpus_mue_10 | 31-45m   Soon I was supposed to start going to kindergarten and then to school, how was that supposed to work if I couldn’t sign?
rSOON4KINDERGARTEN2THEN1ASCHOOL1A*TO-KNOW-OR-KNOWLEDGE2BHOW-QUESTION-COMPARISON1
l
mbaldkindergartendannschuleweißwie
München (Munich) | dgskorpus_mue_10 | 31-45m   But then I realized how nice it was to go to boarding school.
rTHEN1ABOARDING-SCHOOL1BBEAUTIFUL1A$GEST-OFF^*
l
maberschön
München (Munich) | dgskorpus_mue_11 | 31-45f   Next is eyeshadow, eyeliner and mascara.
rEYELID1*COLOUR1A*THEN1A*
lTHEN1A
mdannfarbedann
München (Munich) | dgskorpus_mue_11 | 31-45f   After that it’s time for jewelry, a necklace, bracelet and so on.
r$GEST^$PROD
lTHEN1ANECKLACE1
mhalsschmuck
München (Munich) | dgskorpus_mue_11 | 31-45f   Then I go downstairs and put on perfume.
r
lTHEN1APERFUME2*
mparfüm
München (Munich) | dgskorpus_mue_11 | 31-45f   It's decreasing now, because the East has almost equalized to the West.
rLITTLE-BIT7B*THEN1ATO-DECREASE-STH1A*HIGH1^*
l
mdann
München (Munich) | dgskorpus_mue_11 | 31-45f   He replied again, but - how can I put it - he sort of begged.
rTHEN1AALSO3ATO-SEND-OR-TO-DISPATCH4A*$INDEX1*
l
mdannauchschicken
München (Munich) | dgskorpus_mue_12 | 46-60f   At home, in the kitchen, the father wants to make tea or something.
rTHEN1AAT-HOME1BINTO2$INDEX1
l
mdannzu hause
München (Munich) | dgskorpus_mue_12 | 46-60f   At home, in the kitchen, the father wants to make tea or something.
r$INDEX1KITCHEN3A$INDEX1THEN1AFATHER1TO-WISH1BWHAT1A*
l
mküchevaterwünsch[MG]
München (Munich) | dgskorpus_mue_12 | 46-60f   The son is sitting on the bathtub and reads his book.
rTHEN1ASON1TO-BATH1B*TUB2
l
mdannsohnbadewanne
München (Munich) | dgskorpus_mue_13 | 46-60m   She talked to a nurse, who said that my current situation wasn’t good for me, and that she should rather take me somewhere else.
rMOTHER1*THEN1ANURSE1*$INDEX1TO-LOOK1*
l
mmutterdannkrankenschwester
München (Munich) | dgskorpus_mue_13 | 46-60m   She quickly filled out the application for admission and organised everything.
rTHEN1ATO-GIVE3A^*TO-INCLUDE-OR-TO-ADMIT1TO-SIGN-A-FORM1B
l
mdannmutteraufnahme
München (Munich) | dgskorpus_mue_13 | 46-60m   The people who weren't busy at the tournament shouldn't be bored.
rBUT1*$INDEX1*TOGETHER7THEN1APART3A*NINE-PIN-BOWLING1NOT5
l
maberteilkegelnnichts
München (Munich) | dgskorpus_mue_13 | 46-60m   I was in kindergarten until I was six years old, and then at age seven I got into school.
rUNTIL1$NUM-ONE-TO-TEN1D:6d*KINDERGARTEN1A*THEN1AHOW-QUESTION-COMPARISON1*THEN1A$NUM-ORDINAL1:7d
l
mbiskindergartendannwiedannsieben
München (Munich) | dgskorpus_mue_13 | 46-60m   I was in kindergarten until I was six years old, and then at age seven I got into school.
rKINDERGARTEN1A*THEN1AHOW-QUESTION-COMPARISON1*THEN1A$NUM-ORDINAL1:7dHOW-QUESTION-COMPARISON1*I1*
l
mkindergartendannwiedannsiebenwieschu{le}
München (Munich) | dgskorpus_mue_13 | 46-60m   The town mayor gave a short speech, as well.
rTHEN1AMASTER2CTO-HIRE1A*TO-TALK2
l
mdannbürgermeister
München (Munich) | dgskorpus_mue_13 | 46-60m   Time went by, and I had to do practical training.
rPROCEEDING2THEN1AI1*INTERNSHIP1
l
mkommtpraktisch
München (Munich) | dgskorpus_mue_13 | 46-60m   By the end of the break, the new interpreter came to my training centre. First thing I did was greet him.
rTHEN1AGO-START1^*EDUCATION1*IMPORTANT1^*
l
mdannausbildungferienende
München (Munich) | dgskorpus_mue_13 | 46-60m   I still had to work through all the course material, that was about three meters of piles of task sheets.
rLONG1A$PRODTO-LEAF-THROUGH3THEN1ATO-LEAF-THROUGH3THEN1A
l
m
München (Munich) | dgskorpus_mue_13 | 46-60m   I still had to work through all the course material, that was about three meters of piles of task sheets.
rTO-LEAF-THROUGH3THEN1ATO-LEAF-THROUGH3THEN1A
l
m
München (Munich) | dgskorpus_mue_13 | 46-60m   I was really tired, the interpreter spotted it right away and asked me what was going on.
rTHEN1AINTERPRETER2*TEACHER2*
lTO-COME3*
mdolmetscherlehrer
München (Munich) | dgskorpus_mue_13 | 46-60m   Because of my success, they will be able to accept more and more deaf people into their school in the future.
rTHEN1ADEAF1A*TO-PUT-FROM-TO1A^*CAN1
l
mdannkann
München (Munich) | dgskorpus_mue_13 | 46-60m   Oh, so that’s something that might happen, interesting.
r
lTHEN1AINTEREST1B$GEST-OFF^*
m
München (Munich) | dgskorpus_mue_13 | 46-60m   School lasted a year, followed by an eighteen-month internship.
rYEAR1A*SCHOOL1ATO-STAY2*THEN1A$NUM-TEEN2A:8dMONTH1*INTERNSHIP1
l
mein jahrschuledannachtzehn m{onate}praktikum
München (Munich) | dgskorpus_mue_13 | 46-60m   After I hadn’t passed the first year, #Name3 and my hearing trainer could take turns training me in my second year.
rYEAR1B*NOT1*TO-ACCOMPLISH1C*THEN1ADEAF1A*TO-MOVE2^*$INDEX1
l
mein jahrnichtgeschafftdanngehörlos
München (Munich) | dgskorpus_mue_13 | 46-60m   That way I have helped quite a few deaf people, but I just see it as part of the job.
rVERY4*MUCH-OR-MANY1AI2THEN1ASUGGESTION1A^TO-WORK1*I2*
l
msehrvieleaberzurückmussarbeiten
Rostock | dgskorpus_mvp_01 | 18-30m   The hearing children understand everything and the deaf child just sits around and doesn’t have a clue what is going on.
rDEAF1A*TO-WRITE1D*WHAT-DOES-THAT-MEAN1*THEN1A$GEST-OFF^
l
m[MG]wasdann
Rostock | dgskorpus_mvp_02 | 31-45m   It is followed by the weather forecast that I watch, as well.
rDONE1ATHEN1AWEATHER2REPORT1*TO-LOOK1
l
mfertigdannwetterbericht
Rostock | dgskorpus_mvp_03 | 18-30m   Because she had been there before, she boiled over with emotions concerning the attack with the plane.
rTO-MAKE-USE-OF-STH1$INDEX1*THEN1AAIRPLANE2A^*FEELING3DIFFERENT1
l$GEST-OFF^*
mbenutzendann
Rostock | dgskorpus_mvp_03 | 18-30m   During the next summer break, I visited my aunt who had fled from Eastern Germany before.
rBEFOREHAND4*FLIGHT1AROUND3A^*THEN1AI1TO-VISIT-OR-TO-ATTEND1B*
l
mvorgeflohen
Rostock | dgskorpus_mvp_03 | 18-30m   Then, when school started again, I brought my new pencil case from Western Germany to school.
rTHEN1ASCHOOL1ATO-PRESS-LEVER1A^*I1
l
mdannschule[MG]
Rostock | dgskorpus_mvp_03 | 18-30m   We waited one minute - an entire minute - and remained in silence.
r$NUM-ONE-TO-TEN1A:1dMINUTE2*$NUM-ONE-TO-TEN1A:1dTHEN1ATO-WAIT1A*$NUM-ONE-TO-TEN1A:1dMINUTE2*
l
meinemi{nute}eindannwarteneineminu{te}
Rostock | dgskorpus_mvp_03 | 18-30m   After the minute had passed, we all went back to our classrooms.
rDONE1ADONE4THEN1AMASS-OF-PEOPLE-ACTIVE2*
l
mfertigdann
Rostock | dgskorpus_mvp_03 | 18-30m   When looking through the photos, you could actually notice a car - a Trabant - in some of the photos.
rTHEN1AI1I1TO-LEAF-THROUGH3*
l
m
Rostock | dgskorpus_mvp_04 | 46-60f   At the next appointments, the doctor treated me without an interpreter there.
rDONE1ATO-SIGN1A^*DONE2*
lTHEN1A
mfertigdolmetscherfertig
Rostock | dgskorpus_mvp_05 | 61+m   When the parade was over, we all went to the bar right away to drink a couple of beers.
rTHEN1ATO-MARCH1*BEGINNING1A*FIRST1B
l
manf{ang}
Rostock | dgskorpus_mvp_06 | 61+m   Then, at the end, I worked as a building cleaner for one and a half years.
rUNTIL1^THEN1ALAST1C^TO-CLEAN3A*TO-CLEAN-UP-FLOOR1
l
m[MG]dannzum schlussgebäudereiniger
Rostock | dgskorpus_mvp_06 | 61+m   And since I’m a severely disabled person, my foreman really stood up for me, so there weren’t any problems.
r$GEST-NM^THEN5PROBLEM5*THEN1AUNTIL1DONE1A$GEST-OFF^
l
m[MG]pro{blem}und dannfertig[MG]
Rostock | dgskorpus_mvp_07 | 31-45f   What did you do after you were finished with your exam in Husum?
rTESTING-OR-INSPECTION4DONE2*WHAT1A*
lYOU1THEN1A
mprüfenfertig
Rostock | dgskorpus_mvp_07 | 31-45f   At some point my mother came up to me and said, “I made an appointment for you at my firm.”
rYOU1*TO-LET-KNOW1A*$GEST-ATTENTION1^*THEN1A$GEST-TO-PONDER1^THURSDAY9*TO-MEET1
l
m[MG][MG]donn{erstag}treff
Rostock | dgskorpus_mvp_07 | 31-45f   I’ve been unemployed for only three months during my whole working life.
rTO-WORK1*$MORPH-LESS3*
lMONTH1*THEN1A$GEST-DECLINE1^*$GEST-DECLINE1^*
mdrei m{onate}arbeitslosdann
Rostock | dgskorpus_mvp_07 | 31-45f   Yes, for instance sewing or working with wood.
rONLY2BTO-SEW1TO-GO-THERE2*THEN1AWOOD11*TO-GO-THERE2$INDEX1*
l
mnurnähendannholz
Rostock | dgskorpus_mvp_07 | 31-45f   Then she asked me last March if it was okay for her to send my application to the company.
rTHEN1A$GEST-OFF^*$INDEX1*QUESTION1*
l
m[MG]
Rostock | dgskorpus_mvp_08 | 46-60m   No, no, nothing, only deaf people came to the sports festival/
rNO1BNO2B*THEN1A$GEST-DECLINE1^*NO2B*$GEST^
l
m[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   I went downstairs again in the evening and the TV was still on.
rTHEN1AAROUND-THE-CLOCK7^*EVENING1*I1*
l
mdannnachabendsich
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   People came and lined up so everyone had to wait in a long queue to get their badges.
rTHEN1A$PROD$PROD
l
mschlange
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   The White and the Red Main merge together as one river. They become the River Main.
rWHITE1A$PROD$PRODTHEN1AMAIN1
l
mweißer mainroter main [MG]dannmain
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   They are building this part right now. When they are finished there, they will continue to build the next stage towards Nürnberg.
rBUILDING-OR-CONSTRUCTION1NOW2*TO-COME1THEN1ADONE1A*THEN1ATO-DIVIDE-IN1A^
l
mbauenjetztkommdannfertigdann
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   They are building this part right now. When they are finished there, they will continue to build the next stage towards Nürnberg.
rTO-COME1THEN1ADONE1A*THEN1ATO-DIVIDE-IN1A^$ALPHA1:NDIRECTION3^*
l
mkommdannfertigdannnürnberg
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   The first Saturday of the month is the seventh or eighth of August.
rMEAN-OR-BE-CALLED1B*THEN1A$INDEX1$NUM-ORDINAL1:7d*$NUM-ORDINAL1:8d*
l
mheißensiebteachte
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Luckily, I got picked up.
rTHEN1A$GEST-TO-PONDER1^$INDEX1LATER3*
l
mspäter
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I went there on Friday and, er, yes.
r$GEST-TO-PONDER1^THEN1A$INDEX1$GEST-TO-PONDER1^FRIDAY5*
l
m[MG]freitag
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   On Saturday, four girls who had finished school there invited me to theirs.
rTHEN1ASATURDAY4*TO-INVITE2*$NUM-NUMBER-OF-PEOPLE1:4*
l
msamstageinladen
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Well, they have those badges there.
r$GEST-TO-PONDER1^THEN1ANO-CLUE1^THIS-AND-THAT1*$INDEX1
l
m[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   They start at noon.
rTHEN1AGO-START1$NUM-TENS2A:2d
l
mloszwölf
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   And then I went on my trip.
r$GEST-TO-PONDER1^THEN1AOFF11DONE1A
l
mdannab
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   It’s at the Oktoberfest?
rTHEN1ACLASH1^*
l
mnachoktoberfest
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   I think that’s all there is to say about the Sign Language Festival.
rTHEN1AMORE1END1^FESTIVAL2A*
l
mgebärdenfestvial
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   It’ll start in September when a group will be gathered to organize the party for November.
rGO-START2$INDEX1TOGETHER1A*THEN1ATO-ORGANISE2A*FOR1*PARTY1B*
l
mlosdannfürparty
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Will you be driving to Munich on Saturday?
rTHEN1ASATURDAY4*MUNICH1A*TO1
l
msamstagmünchen
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   It’s soon, yes.
rTHEN1A$GEST^YES1A
l
m
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   Well, what else do I do?
r$GEST^I1LATER10THEN1A
l
m
Nürnberg (Nuremberg) | dgskorpus_nue_04 | 18-30f   But he’s having a party with his friends on the seventeenth, and with his family on the 24th.
r$NUM-ONE-TO-TEN1A:2dWITH1AFAMILY4THEN1A$INDEX1
l
mmitfamilie
Nürnberg (Nuremberg) | dgskorpus_nue_05 | 46-60f   Then, the next thing, and I stayed seated to look at it.
rTHEN1AI1DIFFERENT3SUBJECT1*
l
m{d}ann[MG]anderthema
Nürnberg (Nuremberg) | dgskorpus_nue_05 | 46-60f   And wouldn’t you know it, I got to meet Susanne. What a surprise.
r$GEST-NM^THEN1ADIMPLE1^*TO-MEET2B*I2*
l$NUM-ONE-TO-TEN1A:2d
mund dannsusanne
Nürnberg (Nuremberg) | dgskorpus_nue_05 | 46-60f   Next was Munich; I definitely had to go there, too.
rDONE1A*THEN1AI2*$GEST-OFF^MUNICH1A*
l
mdann[MG]münchen
Nürnberg (Nuremberg) | dgskorpus_nue_06 | 31-45f   The box is put aside and you lie down on the examination couch.
rTHEN1ATO-PUT11*AND2B*THEN1A
l
m
Nürnberg (Nuremberg) | dgskorpus_nue_06 | 31-45f   The box is put aside and you lie down on the examination couch.
rTHEN1ATO-PUT11*AND2B*THEN1ATO-LIE-LEG1ATO-LIE-OR-TO-LAY2*TO-LIE-LEG1A*
l
mliegen
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   Then I asked her to stop.
rTHEN1AI1TO-SUFFER2^TO-SAY4*
l
m[MG][MG][MG]
Nürnberg (Nuremberg) | dgskorpus_nue_07 | 31-45m   There are also some who’ve smoked for 20 years and then managed to quit.
r$NUM-TENS4A:2dYEAR2ATO-SMOKE1A*THEN1ATO-ACCOMPLISH1CTO-END4
l
mzwanzigjahredannschaff[MG]
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   When I was still small, my mom took care of me and at some point, I will take care of my own children.
rMOTHER2*CARE1*THEN1AI1CARE1
lSMALL5*
mkleinmutterpflegedann
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   And then?
rTHEN1A$GEST^
l
mdann
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   Then I will get my Abitur [general qualification for university entrance] in Essen.
rTHEN1AI1$INDEX1*ESSEN-CITY1
l
minessen
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   Until you’re done and then start/
r$GEST-TO-PONDER1^$GEST-TO-PONDER1^DONE1BTHEN1ATO-JOIN1A^*$GEST-OFF^*
l
mfertigdann
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   Then you have to study more in the evening.
rEVENING2*MORE1*
lTHEN1AMUST1
mdannmussabendmehr
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   If you understood everything in that time, you wouldn’t have to study at home. You would’ve already gotten it.
rTO-PERCEIVE-EYE1B^PRESENT-OR-HERE1AROUND-THE-CLOCK7^*THEN1ADONT-NEED1GO-HOME1MORE1*
l
mdadannbrauchheimmehr
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   So they just spoke and I stared at them.
rTHEN1ATO-SPEAK5AI1TO-LOOK-AT1*
l
m[MG][MG]
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   Then, we had trial exams, where I got Ds and Fs.
rTHEN1APERIOD1BTO-TRY-OR-REHEARSAL4TO-WRITE1A^*
l
mdannprobearbeit
Nürnberg (Nuremberg) | dgskorpus_nue_08 | 18-30f   Then, you can decide on what to do.
rTHEN1ATO-DECIDE1B$GEST-OFF^*
l
mdannentscheiden
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   After that we flew to Austr/ to Thailand.
rTHEN1ASTILL5AIRPLANE2A^*$GEST-TO-PONDER1^
l
mdannnoch
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   And then/
rTHEN1A
l
m
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   Where is it going to be in four years?
r$NUM-ONE-TO-TEN1A:4*THEN1AMIDDLE2B*$GEST-OFF^
l
mvier jahrewo
Nürnberg (Nuremberg) | dgskorpus_nue_09 | 18-30m   In Taiwan, I could join fully. Finally, I did it.
rTHEN1ATAIPEI1^$INDEX1CAN2A*
l
mtaiwankann
Schleswig-Holstein | dgskorpus_sh_01 | 18-30m   In case of reduced productivity you can just get rid of them.
rTHEN1APERFORMANCE1$GEST-I-DONT-KNOW1^*TO-TALK-ONES-WAY-OUT-OF-STH2*
l
mdannleistung[MG][MG]
Schleswig-Holstein | dgskorpus_sh_01 | 18-30m   Like the social crisis that happened back in the days of imperator Wilhelm, an economy crisis would be possible today. And then what?
rMAYBE3*ECONOMY1B*CRISIS1*THEN1A$GEST-I-DONT-KNOW1^CAN1*$GEST-OFF^
l
mvielleichtwirtschaftskrisedann[MG]kann
Schleswig-Holstein | dgskorpus_sh_02 | 18-30f   The next day, our teacher at school explained to us what had happened.
rTHEN1ASCHOOL1A*TO1*TEACHER2
l
mdannschulelehrer
Schleswig-Holstein | dgskorpus_sh_02 | 18-30f   When the second plane crashed into the other tower, I immediately understood that it wasn't a normal accident, but rather a terrorist attack.
rI1$NUM-ORDINAL1:2$LIST1:2of2*THEN1AAIRPLANE2F*$INDEX1OVER-AND-DONE1
l
mzweidannaus
Schleswig-Holstein | dgskorpus_sh_02 | 18-30f   After I told you everything, you went back to sleep.
rYOU1TO-LET-KNOW1A*TO-GET-STH-DONE1A*
lTHEN1A
mdannerledigt
Schleswig-Holstein | dgskorpus_sh_04 | 46-60f   But it’s different if I set an appointment beforehand and it gets taken from me.
rAPPOINTMENT1A$INDEX1*TO-TAKE-AWAY1*
lI1THIS-TIME1THEN1A
mterminda{nn}weggenommen
Schleswig-Holstein | dgskorpus_sh_05 | 61+m   They won the title three times in a row now.
rTHEN1AORDER-OR-SUCCESSION1THROUGH1A
lTO-LIST1C*$NUM-ONE-TO-TEN1A:3d
mdanneins zwei dreidurchdreimal
Schleswig-Holstein | dgskorpus_sh_06 | 31-45f   And now he’s Pope Benedict.
rTHEN1A$GEST^POPE2HEADDRESS14^
l
mpapstbenedikt
Schleswig-Holstein | dgskorpus_sh_06 | 31-45f   I also won't attend the Youth festival, which is happening soon.
rALSO1ATHEN1AYOUNG1FESTIVAL2A*$INDEX1
l
mauchjugendfestival
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   That was nice. But it's sad that I can't see the next play in March in Kiel.
rGOOD1*$GEST^TOO-BAD1THEN1AMARCH26INVOLVED1A*THEATRE6
l
mgutaberschademärznicht dabeitheater
Schleswig-Holstein | dgskorpus_sh_07 | 31-45m   Later, the tabloids repeatedly published new stories about the incident but at some point it calmed down.
rPRINT-MEDIA1*ONCE-MORE1B*THEN1ADISSOLUTION1A^*OFF-CLOSED1^*$GEST-OFF^
l$INDEX1*$GEST-OFF^*
mpressewieder[MG]
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   Then, in Schleswig/ in Schleswig there’s a viking festival.
rTHEN1AON-OR-AT1SCHLESWIG1A$INDEX1
l
mamschleswig
Schleswig-Holstein | dgskorpus_sh_08 | 46-60m   There’s the Schönberger beach.
r$INDEX1THEN1A$GEST-TO-PONDER1^$INDEX1BEAUTIFUL3
l
mschönberger strand
Stuttgart | dgskorpus_stu_01 | 46-60f   We went home after a while and watched a subtitled news report.
rGO-HOME1*TO-WATCH1*THEN1ASEGMENT2C*SUBTITLES2NARROW1A^*
l
mzu hausespäteruntertitel
Stuttgart | dgskorpus_stu_01 | 46-60f   I said, “I like that one. May I take it outside to look at it?”
r$INDEX1THEN1AALLOWED1*OUTSIDE1
lI1I1
m[MG]darf ichdraußen
Stuttgart | dgskorpus_stu_01 | 46-60f   Later, I thought that they meant another Diana.
rTHEN1ALATER4*I1TO-THINK1B
l
mdannspätergedacht
Stuttgart | dgskorpus_stu_01 | 46-60f   I also started to follow all that, why and what exactly had happened.
rTHEN1AALSO3AI1BEGINNING1A*
l
mdannauchanfangen
Stuttgart | dgskorpus_stu_01 | 46-60f   There were some people who at times knitted and photographed their work afterwards.
rSOMETIMES1*ALSO1ATO-KNIT1THEN1APHOTO1
l
mmanchmalauch strickenfoto
Stuttgart | dgskorpus_stu_03 | 31-45m   All of a sudden, many more people joined.
rTHEN1AI2*SUDDENLY1C*COME-HERE1*
l
mdannauf einmal
Stuttgart | dgskorpus_stu_03 | 31-45m   If they still complain about something, however, I don't think that’s okay.
rTHEN1ASUGGESTION1B^I2*$GEST-OFF^
l
mdannbeschweren[MG]
Stuttgart | dgskorpus_stu_04 | 61+f   I felt somewhat sorry for them.
rTHEN1ABIT4*TO-SUFFER2*$GEST-OFF^
l
mdannbisschenleiden
Stuttgart | dgskorpus_stu_04 | 61+f   Later on, when I was twelve, my little brother was born.
rTHEN1ALATER10I1$NUM-TEEN6A:2d
l
mdannspäterichzwölf
Stuttgart | dgskorpus_stu_05 | 61+m   My sister came first, then me.
rSISTER1C*I1THEN1AI1*$GEST-OFF^
l
mschwes{ter}dann
Stuttgart | dgskorpus_stu_05 | 61+m   I often fell asleep during political science class because they only spoke.
r$INDEX1THEN1AHISTORY-OR-STORY2^*POLITICS1*$INDEX1
l
m[MG]politik
Stuttgart | dgskorpus_stu_05 | 61+m   I used to take my wife with me and often also another woman. They even met other persons they already knew and so they liked it.
rTHEN1AMY1*
lWOMAN1ATO-TAKE-SB-OR-STH-ALONG1*
mdannmeinfraumit
Stuttgart | dgskorpus_stu_05 | 61+m   Up until eleven years ago I was president. To me this time felt like a hundred of years. Since then I am fed up with it, I don’t want to do it anymore. The events there are over and out for me.
rI1REALLY2*I1THEN1A$NUM-HUNDREDS1:1YEAR1B*TO-PART-TO-CUT-BODY-PART1A^*
l
mpräsidentdannhundertjahre[MG]
Stuttgart | dgskorpus_stu_06 | 18-30f   Once that’s done, then/
rTO-STAY2*THEN1A
l
m[MG]dann
Stuttgart | dgskorpus_stu_06 | 18-30f   I also wanted to organize going to the Christmas market in December.
rTO-WANT7*ALSO3A*TO-ORGANISE2ATHEN1ADECEMBER3ACHRISTMAS4A*MARKET7
l
mwollteauchdezemberweihnachtsmarkt
Stuttgart | dgskorpus_stu_06 | 18-30f   Well, I want to do that soon.
rI1TO-WANT1B*THEN1A
l
michwill
Stuttgart | dgskorpus_stu_06 | 18-30f   I’ll just wait and see.
rTHEN1AWHAT-DOES-IT-LOOK-LIKE1*$GEST-OFF^
l
mdannwie sieht aus[MG]
Stuttgart | dgskorpus_stu_06 | 18-30f   After having thought about it and doing the math again, I feel like I would be spending too much money.
rTO-THINK1BI1TO-CALCULATE1THEN1A
lTO-LIST1C
m[MG]
Stuttgart | dgskorpus_stu_08 | 61+f   The next day, a deaf person said they wanted to have such shoes, as well.
r
lTHEN1AAN1ADEAF1A*TO-SAY4*
mdann
Stuttgart | dgskorpus_stu_09 | 18-30m   After, she is supposed to wash her face; I also help her a little with that to make sure she really washes everything.
rTHEN1AI1TO-WASH-FACE1AI1
l
mdannwaschen
Stuttgart | dgskorpus_stu_09 | 18-30m   I started out in Winnenden, but I was then transferred to another department.
rBEGINNING1A*TO-JOIN1A*THEN1AI1*TO-PUT-FROM-TO1A^*
l
manfangdann
Stuttgart | dgskorpus_stu_10 | 18-30m   Then in school, I was forced to learn with the oral method from the first until the fifth grade.
rTHEN1AI2TO-JOIN1A*$NUM-ORDINAL1:2d*
l
mdann
Stuttgart | dgskorpus_stu_10 | 18-30m   In fifth grade we got a new teacher who could sign.
r$NUM-ORDINAL1:5CLASS2THEN1ANEW4ATO-MOVE1^*TEACHER1
l
mfünfteklasseneulehrer
Stuttgart | dgskorpus_stu_10 | 18-30m   Then I moved into a living community.
rTHEN1AI1TO-SWAP3A$ALPHA1:W-G
l
mdannw-g
Stuttgart | dgskorpus_stu_10 | 18-30m   During my apprenticeship, I was renting a private flat.
rTHEN1AEDUCATION1*I2PRIVATE1A*
l
mdannausbildungprivat
Stuttgart | dgskorpus_stu_10 | 18-30m   Only from fifth grade onward did we get a teacher who could sign.
rTHEN1ATO-SWAP3A*TEACHER1PERSON1
l
mdannlehrer
Stuttgart | dgskorpus_stu_10 | 18-30m   When I moved to Essen, it wasn’t an issue anymore.
rTHEN1AESSEN-CITY1*TO-MOVE1*TOTALLY-FINE1*
l
mdannessen[MG]
Stuttgart | dgskorpus_stu_12 | 46-60f   Yes, next year in April.
rTHEN1A
lAPRIL4YES1A
mnächstes jahraprilja
Stuttgart | dgskorpus_stu_13 | 31-45f   If all three guys are motivated you can get better, though.
rFRIEND7ALL2BGREAT1ATHEN1ATO-ACCOMPLISH1AABOVE2A^*GOOD1^*
l
mkumpelalle[MG]dannschaffennicht schlimm
Stuttgart | dgskorpus_stu_14 | 46-60m   In eight years, that worked out for me no more than one or two times.
rTHEN1AI1$NUM-ONE-TO-TEN1A:10YEAR1B*
l
mdannacht jahr
Stuttgart | dgskorpus_stu_15 | 61+f   Yet, I find it sad that it leads to the number of deaf people decreasing in the future.
rFEELING3LIKE4B*DEAF1ATHEN1AFUTURE1ADISSOLUTION1A^I1*
l
m{ge}fühlwiegehörloszukunft[MG]finde ich
Stuttgart | dgskorpus_stu_16 | 31-45f   Take beer for example: Nowadays it is twice as expensive and if you are ordering a second beer, you're thinking twice about it because it's so expensive.
r$PRODDOUBLE1ASUDDENLY4*
lBEER1THEN1ABEER3
mbier[MG]doppelt
Stuttgart | dgskorpus_stu_16 | 31-45f   He added a voluntary additional pension plan of a five year length to his regular retirement payments.
rCOHERENCE1A^TO-BELONG1^*USUAL1*THEN1APENSION1*VOLUNTARY1ADDITIONAL1*
l
mnormalrentefreiwilligzusatz
Stuttgart | dgskorpus_stu_16 | 31-45f   After he already payed for the insurance for five years, there was a pension plan reform.
rADDITIONAL1*INSURANCE2*UPDATE1B^*THEN1ARESULT1$INDEX1*TO-KNOW-OR-KNOWLEDGE2B^
l
mzusatzversicherungdannergebnis
Stuttgart | dgskorpus_stu_18 | 18-30m   After lunchtime, there was a one hour break before lessons started again.
rCAN2AHOUR2B*TO-LET1SCHOOL1A*
lTHEN1A
mkanneine stunde[MG]dannschule
Berlin | dgskorpus_ber_01 | 18-30m   Right, it's better to be in good company. Now, even if we were in the same class in Essen, our lives take separate paths because of the different work places and apprenticeships we chose.
rI1ESSEN-CITY1CLASS5*THEN1A*DIFFERENT1TO-LIVE1A*WAY2A*
l
messendannanderleben
Berlin | dgskorpus_ber_02 | 46-60m   I stayed there until I was done with school. I then started my apprenticeship.
rEND1^*OFF1A*I1*THEN1A*EDUCATION1*TO-JOIN1A^*$INDEX1*
l
mabausbildungund dann
Berlin | dgskorpus_ber_02 | 46-60m   I didn‘t attend the next ones in 1985 in Los Angeles.
rTHEN1A*$NUM-ONE-TO-TEN1A:5*$NUM-TENS1:8d*$INDEX1
l
mdannfünfundachtzig
Berlin | dgskorpus_ber_02 | 46-60m   Just like the most recent winter games of the C-I-S-S that were canceled; let‘s see what happens next.
r$ALPHA1:C-I*TO-BE-CANCELLED1*TO-COME1*THEN1A*
l
mc-i-s-sauskommt[MG]
Berlin | dgskorpus_ber_02 | 46-60m   Yes, all the money was gone.
rTHEN1A*GONE-TO-VANISH1WHERE1ATO-TAKE-AWAY2*
l
mund dannwo
Berlin | dgskorpus_ber_03 | 46-60f   I saw a person crying once again; they looked so happy.
rI2TO-LOOK-AT2THEN1A*AN1ATO-CRY1*INVOLVED1A^*
l
mdannwieder ein[MG]mit
Berlin | dgskorpus_ber_04 | 46-60m   Then I became a top-ranking athlete.
rTHEN1A*COURSE-OF-TIME1SELF1A*PAST-OR-BACK-THEN1*
l
mdann[MG]selbstfrüher
Berlin | dgskorpus_ber_04 | 46-60m   The whole team trained very hard and we even participated in a workshop.
rTHEN1A*ALL1BDILIGENT1WORKOUT1
l
mdannallefleißigtraining
Berlin | dgskorpus_ber_04 | 46-60m   I was also an athlete for athletics in Cologne.
rTHEN1A*FURTHER1B*ATHLETICS1*COLOGNE2
l
mdannweiterleichtathletikköln
Berlin | dgskorpus_ber_05 | 61+f   Maybe the other driver, who was calling, organized it on the phone for me after I told them I was deaf, that’s why they came.
rTO-KNOW-OR-KNOWLEDGE2A*$GEST-OFF^*$INDEX1*THEN1A*
lTO-COME1*
mweiß nicht
Berlin | dgskorpus_ber_05 | 61+f   I was so scandalized, so now, they have a big remark in their book that I, Mrs. Jauering, can’t wait. Big and fat and underlined in read.
rTO-FEEL-INDIGNANT1I1LATER6THEN1A*PHYSICIAN1*TO-LET-KNOW1ATO-WRITE1A
l
m[MG]späterdannschreiben
Berlin | dgskorpus_ber_06 | 31-45m   Me and my mum went to school. She asked my teacher whether the other deaf children in my class really spoke well, and if so, why my speaking was bad.
rTHEN1A*TO-GO-THERE1*SCHOOL1B*TO-GO-THERE1*
l
mschule
Berlin | dgskorpus_ber_07 | 31-45m   After that, you take a sieve.
rTHEN1A*SIEVE2*$ALPHA1:S-I-B*SIEVE2
l
mdannsieb
Berlin | dgskorpus_ber_08 | 46-60f   That went on until I started going to school. From first grade on I went to a school for the hard of hearing in Berlin.
rPROCEEDING1^*SCHOOL1A*$NUM-GRADE1:1d
lTHEN1A*I1
mdannschuleklasse
Berlin | dgskorpus_ber_08 | 46-60f   In my case it was different. Until seventh or eighth grade. Yes, that was how it went.
r$PRODEND1^*TO-INTERRUPT3*THEN1A*$PRODRIGHT-OR-AGREED1A
l
mzwischen[MG]dannstimmt
Berlin | dgskorpus_ber_09 | 18-30f   As the cat is done, it takes a rope.
rTHEN1A*ROPE2*
l
mseil
Berlin | dgskorpus_ber_09 | 18-30f   What’s interesting as well is that, there, a woman gets pregnant, has a child, and then it just keeps going until she has a whole lot of kids.
rTOGETHER3A*$GEST^THEN1A*SELF1A*PREGNANT1BBIRTH1A*
l$INDEX1$INDEX1
mdann
Berlin | dgskorpus_ber_09 | 18-30f   After a year, a child is born, then they have sex and the next baby is on the way.
rDONE1BTHEN1ATOGETHER3A*THEN1A*BIRTH1A$GEST-OFF^
l
m
Berlin | dgskorpus_ber_09 | 18-30f   And as the woman exists the Café, the other woman follows her, until it gets noticeable.
rTHEN1A*WOMAN4A*$PROD
l$INDEX1*
mfrau
Berlin | dgskorpus_ber_10 | 31-45m   Then we’re good to go.
rTHEN1A*$INDEX1*NEXT1*I1*
l
mdann
Berlin | dgskorpus_ber_10 | 31-45m   I don’t know what happened after that.
r$GEST-OFF^*THEN1A*TO-KNOW-OR-KNOWLEDGE2A*NOT5*I1
l
m[MG]dannweiß
Berlin | dgskorpus_ber_11 | 61+m   There will always be new deaf people.
r$INDEX1THEN1A*NEW1A*
l
mneu
Berlin | dgskorpus_ber_12 | 31-45f   That's why it was a must for me/ There is only one exception and that is at work.
rTHEREFORE1*THEN1A*MUST1*ONLY2A*$NUM-ONE-TO-TEN1A:1
l
mdarummussnurein
Berlin | dgskorpus_ber_12 | 31-45f   They write something down, and you can get in for free.
rTHEN1A*TO-WRITE1AIT-WORKS-OUT1^INTO2*
l
mdann[MG]
Berlin | dgskorpus_ber_12 | 31-45f   The school is very interesting, because I used to go there, and now my children do.
rSCHOOL1A$INDEX1$GEST-OFF^*THEN1A*CHILD2*$INDEX2DONE1A*
l
mschuledannkinder
Berlin | dgskorpus_ber_13 | 31-45f   By the time you were born, people considered the time of my youth a rather bad time, but I never experienced it like that.
rTHEN1A*PERIOD1A^*BETWEEN1C*PERIOD1A^*
l
mdannzwischen
Frankfurt | dgskorpus_fra_01 | 18-30m   I helped at the counter for one, but I also participated in the theater performance right after.
rI1TO-SELL1*DONE1A*THEN1A*$PRODWITH1ATO-MAKE2
l
mfertigdannmitmachen
Frankfurt | dgskorpus_fra_01 | 18-30m   Then it was over and we closed the doors.
rTHEN1A*DONE4CLOSE-DOOR1*
l
mdannzu
Frankfurt | dgskorpus_fra_01 | 18-30m   Many Germans swapped ideas on how to build a system - an alarm system - and to set it up in different places.
rHERE1
lTHEN1A*MUCH-OR-MANY1AGERMAN1
mdannvieldeutsche
Frankfurt | dgskorpus_fra_02 | 31-45m   I’ll get to that in a second. First, I want to say something about another point.
rQUESTION1*$INDEX1*TO-STAY2*THEN1A*
l
mfrage
Frankfurt | dgskorpus_fra_04 | 61+m   I was then asked whether it was good.
rTHEN1A*QUESTION1*TO-PLEASE2*
l$INDEX1
mfrage
Frankfurt | dgskorpus_fra_06 | 31-45f   In the morning, I/
rI1THEN1A*I1EARLY2^
l
michmorgens
Frankfurt | dgskorpus_fra_06 | 31-45f   Then I went to boarding school.
rTHEN1A*TO-GO-THERE1BOARDING-SCHOOL1BI1
l
mdanninternat
Frankfurt | dgskorpus_fra_06 | 31-45f   Then all of us lifted up the chair as many times as the age of the birthday child.
rTHEN1A*$PRODATTENTION1A^*AFTER1*
l
mdannhoch hoch
Frankfurt | dgskorpus_fra_06 | 31-45f   In the bar, someone pointed Puttrich out to me.
rBAR7$PRODAREA1A^*THEN1A*TO-LET-KNOW1A*$INDEX1$NAME-GUNTER-PUTTRICH1
l
mbarputtrich
Frankfurt | dgskorpus_fra_06 | 31-45f   I went up to him and he shook my hand.
rTHEN1A*TO-MEET2BTO-WELCOME3$PROD
l
m[MG]
Frankfurt | dgskorpus_fra_06 | 31-45f   I retreated to my room and closed the door to be able to study in peace.
rI1$INDEX1I1THEN1A*CHAMBER1B*MY1CHAMBER1B*
l
mdannzimmer
Frankfurt | dgskorpus_fra_06 | 31-45f   So I went there and was informed about the different possibilities there were, which I didn't know anything about before.
rI1TO-GET-IN1$INDEX1THEN1A*EXPERIENCE-OR-KNOWLEDGE6C*$INDEX1*LIKE-THIS3*
l
merfahrungso
Frankfurt | dgskorpus_fra_07 | 18-30m   There, she gives the passports to the group.
rLAST1D*TO-SPEND-OR-TO-DISTRIBUTE1^THEN1A*TO-GET-STH-DONE1ADEPARTURE1$GEST-OFF^
l
mle{tzte}geben geben geben gebendannerledigt
Frankfurt | dgskorpus_fra_07 | 18-30m   At eight o’clock, or rather, a little bit earlier, everyone is supposed to meet outside.
rDONE1BTHEN1A*$NUM-CLOCK1A:8d*MUST1BEFORE1E*
l
mfer{tig}dannacht uhrmussvor
Frankfurt | dgskorpus_fra_07 | 18-30m   I think once I am older, I will be sick of that and then be more interested in culture.
rCULTURE1A*INTEREST1A
lSOMETIME1*OLD4BTO-BE-SICK-OF-STH1THEN1A*DIRECTION3*
malt[MG]kul{tur}[MG]
Frankfurt | dgskorpus_fra_07 | 18-30m   That way I would make a great memory.
rEXPERIENCE1A*THEN1A*TO-LEAD4^BEAUTIFUL1A*MEMORY-OR-REMINDER2
lRATHER1*ONCE1A*
meinmalliebererlebendafürschönerinnerung
Frankfurt | dgskorpus_fra_08 | 18-30f   It used to be prohibited to use sign language in class for quite some time, not even talking to your seat mate.
rTIME3*PAST-OR-BACK-THEN2$GEST-NM-NOD-HEAD1^THEN1A*PERIOD1D$INDEX1*ATTENTION1*
l
mzeit[MG]dannauch
Frankfurt | dgskorpus_fra_08 | 18-30f   Then, I joined the hard of hearing class.
rTHEN1A*TO-JOIN1BTO-JOIN1B*CLASS9
l
m
Frankfurt | dgskorpus_fra_08 | 18-30f   I learned a lot through that, as well as from my parents.
rOKAY1A*THEN1A*COHERENCE1A^LATER4*THROUGH2B*
l
mokaydanndurch
Frankfurt | dgskorpus_fra_08 | 18-30f   I wanted them to accept me staying in the deaf class and still believe that I could be successful and make it.
rTO-JOIN1A^*TO-WANT6*THROUGH1A*THEN1A*MEANING1*I1ALSO3A*
l
mwillbedeutetauch
Frankfurt | dgskorpus_fra_08 | 18-30f   They told me that if I had a deaf boyfriend, the next generation, my children, would automatically also be deaf.
rDEAF1ABOYFRIEND-GIRLFRIEND1THEN1ATHEN1A*GENERATION4*CLOSE-BY1^*TO-GROW2A^*
l
mdannnächstegenerationnachwuchs
Frankfurt | dgskorpus_fra_08 | 18-30f   My mother and I had a heated discussion about that.
rTHEN1A*MUM3TO-LOOK-AT1*$GEST-OFF^
l
mdannmama
Frankfurt | dgskorpus_fra_10 | 61+f   We got up at 5 am and walked down into the canyon and back up again later.
rEARLY-MORNING-$CANDIDATE-FRA23^$NUM-ONE-TO-TEN1A:5TO-GET-UP1*THEN1A*TO-RUN8TO-RUN9BUNDER3*
l
m{früh} morgenfünf uhraufstehendannlaufbis unter
Frankfurt | dgskorpus_fra_11 | 18-30m   I stayed there for three years.
rTHEN1A*TO-DEVELOP2*TO-GROW2C^*UNTIL1
l
mbis
Frankfurt | dgskorpus_fra_11 | 18-30m   So when I began my apprenticeship I was thrown in at the deep end.
rTHEN1A*TO-JOIN1AVERY6LIKE3B
l
m[MG]wie
Frankfurt | dgskorpus_fra_11 | 18-30m   I think she got eliminated during the fifth or sixth week.
r$NUM-ORDINAL1:5$NUM-ORDINAL1:6d*ROW1^*THEN1A*SUDDENLY4SELF1A*RESIGNATION-OR-DISMISSAL2A^*
l
mfünftesechstewoche[MG]selberraus
Frankfurt | dgskorpus_fra_12 | 61+m   My mother commended me.
rMOTHER1*TO-PRAISE1*THEN1A*
l
mloben
Frankfurt | dgskorpus_fra_12 | 61+m   I didn't want to stay there any longer.
rI2THEN1A*I1*TO-PUT1*TO-WANT5
l
mwill
Frankfurt | dgskorpus_fra_14 | 31-45f   But I still hadn't had a job.
rTHEN1A*I1STILL4A*NOT-YET2*
l
mdannnochnoch nicht
Frankfurt | dgskorpus_fra_14 | 31-45f   After that, they told me now was a great time to be an entrepreneur.
rTHEN1A*TO-LET-KNOW1A*CAN2ATO-CHANGE1A
l
mdannkann
Frankfurt | dgskorpus_fra_14 | 31-45f   If these things are clear, everything else can be worked out.
rCLEAR1B*EVERYTHING1BCLEAR1B*THEN1A*SOMEHOW2EVERYTHING1C*I1
l
mklarallesklardann[MG]alles
Frankfurt | dgskorpus_fra_14 | 31-45f   Until I informed him that it was decided, he had already organized three other people to join.
rI1TO-LET-KNOW1A*SOLID1THEN1A*$INDEX1TO-SEARCH1FOR1*
l
mbescheidfestdannsuchenfür
Frankfurt | dgskorpus_fra_16 | 31-45f   They say it takes another 25 years until publication. I think until 2040.
rSTILL1A$NUM-ONE-TO-TEN1A:5$NUM-TENS1:2dTHEN1A*MEANING3*I1TO-BELIEVE2A
l
mnochfünfundzwanzigdannbedeu{tet}glaube
Göttingen | dgskorpus_goe_01 | 61+m   I had hardly hurt myself before.
rTHEN1A*INJURY1AHARDLY1INJURY1A
l
mdanachverletztkaumverletzt
Göttingen | dgskorpus_goe_01 | 61+m   Due to my joint-disease I resigned from active sports and do a lot less.
rTHEN1A*THROUGH2ASICK1I1*
l
mdanndurchkrankheitich
Göttingen | dgskorpus_goe_01 | 61+m   Then the number of people in the group decreased.
rTHEN1A*LITTLE-BIT7A*
l
m[MG]
Göttingen | dgskorpus_goe_02 | 61+m   I started to smoke after a break up eleven years ago.
rTHEN1A*$GEST-OFF^*$NUM-TEEN2B:1dYEAR2B
l
mdannelfjahr
Göttingen | dgskorpus_goe_03 | 61+f   When the first brother was killed, I was still too young to understand, so she probably told me when the second brother died.
rCERTAIN2*BROTHER1A*$INDEX1*THEN1A*LATER5*TO-TELL4$GEST-OFF^*
l
mstimmtbru{der}spätererzählen
Göttingen | dgskorpus_goe_04 | 31-45m   My friend #Name3 is my teammate on the volleyball team.
rI1FRIEND1
lTHEN1A*$INDEX1*
mdannmeinfreund
Göttingen | dgskorpus_goe_04 | 31-45m   Then this crisis, this global crisis happened.
rTHEN1A*SUDDENLY4^*SUDDENLY4^*MONEY1A*
l
m[MG][MG]
Göttingen | dgskorpus_goe_04 | 31-45m   That worked well with us, so we made it happen.
rTOMORROW1A*$GEST-NM-NOD-HEAD1^*IT-WORKS-OUT1*THEN1A*
l
mmor{gen}dann
Göttingen | dgskorpus_goe_05 | 31-45m   The EU gives them the money which we paid for.
r$INDEX1THEN1A*MONEY1ATO-GIVE-MONEY2A*WE1B*
l
mgeldgeld geld
Göttingen | dgskorpus_goe_05 | 31-45m   When that is done it's straight again.
rDONE2*THEN1A*COMPARISON1A
l
mfertigdann[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   Then it was the turn of some carpenters, some tracers and many others.
rTHEN1A*CARPENTER1B*$GEST-OFF^TECHNOLOGY1*
l
mdanntischlertechnisch
Göttingen | dgskorpus_goe_07 | 18-30m   Then we drove to our informational booth.
rTHEN1A*TO-DEPART1$INDEX1$ALPHA1:I
l
minfostand
Göttingen | dgskorpus_goe_07 | 18-30m   The interview was recorded and then shown at the theater festival.
rINTERVIEW3DONE2*MOVIE3*THEN1A*SOURCE-TO-EMANATE1^*
l
minterviewfertigfilmdann[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   After that, they had to get back up immediately, and said it was impossible to keep on fixing, because the water was rising.
rFAST2ABOVE1*BACK1A*THEN1A*DIFFERENT1^*TO-KNIT1^*POINTLESS3A
l
mschnellzu{rück}[MG]
Göttingen | dgskorpus_goe_07 | 18-30m   The jury sat on the side and discussed who should win the prize.
rTHEN1A*$INDEX1TO-TICK1A^*TO-TICK1A^*
l
mdannjury
Göttingen | dgskorpus_goe_07 | 18-30m   When the plays were done, the people went outside and left the jury to discuss their decision in peace.
r$INDEX1*$GEST-OFF^*DONE2*THEN1A*MASS-OF-PEOPLE-ACTIVE1*$INDEX1*DISCUSSION1A*
l
mwennfertigdann[MG][MG]
Göttingen | dgskorpus_goe_08 | 18-30f   That way they could learn both, how to speak and how to sign.
rTHEN1A*PARALLEL2BOTH2ATO-SPEAK6
l
mdannparallelbeidessprechen
Göttingen | dgskorpus_goe_09 | 61+f   After, I distribute the seeds into the many small holes.
rTHEN1CTO-PUT-IN4THEN1A*HOLE1B*TO-PUT-IN4*SEED6A
l
m[MG]loch[MG]samen
Göttingen | dgskorpus_goe_09 | 61+f   A little bit later we went back to the window but again there was someone with a flashlight outside of the building.
rTHEN1A*ONCE-AGAIN2C$PRODOFTEN1B
l
m[MG]noch maloft
Göttingen | dgskorpus_goe_09 | 61+f   But everything was taken off and washed.
rTHEN1A*OFF1ATO-WASH1A*OFF1A*
l
mda{nn}abwaschenab
Göttingen | dgskorpus_goe_10 | 46-60m   They said yes and we sat next to them.
rYES2LIKE-THIS1ATHEN1A*TO-SIT1A
lI1
mdannsitzen
Göttingen | dgskorpus_goe_10 | 46-60m   When we finished our food, I left with the deaf Taiwanese.
r$GEST-OFF^*I1*DONE1A
lTHEN1A*
mdannfertig
Göttingen | dgskorpus_goe_10 | 46-60m   What if there’s no wind, what then?
rWIND2SILENT4THEN1A*$GEST-OFF^
l
mwindstillund dann
Bremen | dgskorpus_hb_01 | 31-45m   You walk for two to four hours. Along the way you take breaks and play games before you get to eat.
rTO-EAT-OR-FOOD2*THEN1A*TO-GO-FOR-A-WALK1HOUR2A*HOUR2A*
l
mes{sen}[MG]zwei stundenvier stunden
Bremen | dgskorpus_hb_01 | 31-45m   If another person throws the ball closer to the aim, you need to drink several shots; it gets on your nerves after a while.
rEXHAUSTING1ON-PERSON1^TO-DRINK2B*THEN1A*
l
m[MG]
Bremen | dgskorpus_hb_04 | 18-30f   I remember, I had theme-work teaching at that time and the Youth Festival happened right in the middle of it.
r$INDEX1BETWEEN1B*$INDEX1
lTHEN1A*
mzwischen
Bremen | dgskorpus_hb_04 | 18-30f   On Saturday, programs were offered the whole day, and on Sunday just shortly, until lunchtime.
rAND-THEN2SATURDAY1PROGRAM1BTHEN1A*SUNDAY1BPROGRAM1BNO1A
l
msamstagprogrammdannsonntagprogramm
Bremen | dgskorpus_hb_04 | 18-30f   And it is just supposed to look like a plane crash or a car crash, but it really isn't.
rTO-SHOW1AAIRPLANE2C*$GEST^THEN1A*$INDEX1*ACCIDENT2A$GEST^
l
mzeigenabsturzdannun{fall}
Bremen | dgskorpus_hb_04 | 18-30f   And after a short while the next event slid by.
rTHEN1A*$PROD
lSOURCE1A^*
mdann[MG]vorbei
Bremen | dgskorpus_hb_04 | 18-30f   It told the whole story from the beginning on up to this Youth Festival which was the last sequence.
rFESTIVAL1LAST1AUNTIL-THEN2^*THEN1A*$PROD
l
mletzte[MG]
Bremen | dgskorpus_hb_04 | 18-30f   This is portrayed in many movies, where one person is hired to kill another one, but that hit man hires another on and so on and so forth to the actual murderer.
rTO-LET-KNOW1ATHEN1ATO-LET-KNOW1ATHEN1A*$INDEX1GO-START1*SHALL1*
l
mdanndann dann dannlossoll
Bremen | dgskorpus_hb_04 | 18-30f   One had to retrace every single man of the chain to get to the murderer.
rMUST1$INDEX1TO-CATCH-SB1A$INDEX1TO-CATCH-SB1A
lTHEN1A*THEN1A
mmussdanndann
Bremen | dgskorpus_hb_04 | 18-30f   One had to retrace every single man of the chain to get to the murderer.
r$INDEX1*TO-CATCH-SB1ATHEN1A*LONG-TIME1B*UNTIL1I1
lTHEN1A
mdann[MG]bis
Bremen | dgskorpus_hb_05 | 61+f   I met more and more people in the deaf club here.
rTHEN1A*HERE1*HOUSE1A^I1
l
mdannhierfreizeitheim
Bremen | dgskorpus_hb_05 | 61+f   We'll soon go on a trip.
rTHEN1A*MASS-OF-PEOPLE-ACTIVE6^*$GEST-OFF^TO-GO-THERE1
l
m[MG]ausflug
Bremen | dgskorpus_hb_05 | 61+f   When they get home, though, and still sign then the daughter gets mad and rants and raves at the grandparents.
rTHEN1A*GO-HOME2$PROD$INDEX2
l
mdannnach hause
Bremen | dgskorpus_hb_05 | 61+f   Braunschweig wasn't a boarding school, and well.
r$GEST^THEN1A*BRUNSWICK1*SECRET1B^$INDEX1*
l
mdannbraunschweig
Bremen | dgskorpus_hb_07 | 18-30m   Then spring arrived and they told me, that I should hurry up a little if I wanted to have it done and be over with.
rCLOSE-BY2A^
lTHEN1A*SPRING1A$INDEX1TO-LET-KNOW1A*
mfrühling
Bremen | dgskorpus_hb_07 | 18-30m   The driving test examiner was standing slightly next to the road. I was supposed to speed up to 50 km/h, and when he lowered his arm, I was supposed to make a hard stop.
r$INDEX1*$PRODTHEN1A*FULL2A$PROD
lMAN1BREAK1
mmannvollbremsung
Bremen | dgskorpus_hb_08 | 61+m   One had a feeling of freedom there. That was nice.
rFREE1GOOD1*
lTHEN1A*
mfrei
Bremen | dgskorpus_hb_08 | 61+m   We actually went into the ship lift once, and our boat was lifted to the top.
r$NUM-ONE-TO-TEN1A:1dSHIP1THEN1A*WITH1A*SHIP1*$PROD
lSHIP1*SHIP1*
meinmaldannmitschiff[MG]
Bremen | dgskorpus_hb_08 | 61+m   Then we were lifted without out the water discharging sideways. It worked.
rTHEN1A*TO-LIFT-UP8^*$PROD$GEST-NM-SHAKE-HEAD1^
lTO-LIFT-UP8^*TO-LIFT-UP8^*
mdann[MG]
Bremen | dgskorpus_hb_08 | 61+m   The ship went out of the first lock and into a second one. It was then lowered again. That was the trip.
rTHEN1A*SHIP1*$PRODONCE-MORE1B*
l
mschiffwieder
Hamburg | dgskorpus_hh_01 | 61+m   It would be better to focus just on some tasks rather than taking on too much in the future. That would be a good alternative.
rTHEN1A*MUST1*$LIST1:1of1dTO-LIST1A^*
l
mdannmusseinsab ab
Hamburg | dgskorpus_hh_01 | 61+m   Maybe more people would join because you would do a better job.
r$GEST-OFF^*THEN1A*MASS-OF-PEOPLE-ACTIVE2*$INDEX1BETTER1*
l
mvielleichtdannvielleichtbesser
Hamburg | dgskorpus_hh_03 | 46-60m   And suddenly they also showed how in the meantime one plane flew into the Pentagon, and also how another plane was hijacked.
r$INDEX1THEN1A*THEN1ASUDDENLY4*TO-SHOW1A*
l
mdanndann[MG]zeigen
Hamburg | dgskorpus_hh_03 | 46-60m   And suddenly they also showed how in the meantime one plane flew into the Pentagon, and also how another plane was hijacked.
r$INDEX1ROUND13B^*TO-LAND1A*THEN1A*DIFFERENT1*TO-KIDNAP1*AIRPLANE2A*
l
mpentagondannandereentführen
Hamburg | dgskorpus_hh_03 | 46-60m   They were split into a women's group, a men's group, and a group for the children.
rTO-HIRE1A*THEN1AMISTER1THEN1A*CHILD2*$GEST-OFF^
l
mherrenkinder
Hamburg | dgskorpus_hh_05 | 31-45m   So, we thought about the matter and finally founded the theater.
rTO-PLAN-AND-GO-THROUGH-WITH-STH1THEN1A*TO-FOUND2
l
m[MG][MG]
Hamburg | dgskorpus_hh_05 | 31-45m   And that was around the time I joined the “Visuelle Theater”.
rAND5THEN1A*$INDEX1OR1*WHAT1A*
l$INDEX1$INDEX1$INDEX1LIKE-THIS4
munddannoderso was
Hamburg | dgskorpus_hh_05 | 31-45m   We played that piece on a regular basis until Marco left and Susanne moved away.
rPERIOD1A^THEN1A*PERIOD3^$INDEX1PLAY1
l
mdannstück
Hamburg | dgskorpus_hh_07 | 18-30f   And now, integrative lessons.
rTHEN1A*INTEGRATION1*
l
mdanninte{gration}
Hamburg | dgskorpus_hh_08 | 46-60f   A couple of months later we drove to the bar, only this time Gunter just wasn’t with us anymore.
rTO-DRIVE3*
lTHEN1A*TO-LIST1CMONTH1*
mund dannein paarmonat
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   But not for me, I’m growing older and older. I am turning #X soon.
rI1*$GEST-I-DONT-KNOW1^I1*THEN1A*$NAME$NAME$NAME
l
mich nichtaberichwerde bald#x#x#x
Köln (Cologne) | dgskorpus_koe_02 | 46-60f   But I really wanted the interpreters to translate for me.
rI1TO-SAY2ANO2B*THEN1A*I1INTERPRETER1*INTERVIEW2^*
l$INDEX1
mhab ichgesagtdolmetscher[MG]
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   Then they got rid of the suspenders and the pants slid down.
rTHEN1A*OFF1A*$PROD
lLATER4*
mab[MG]
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   Then even lower all the way down to the waist.
rTHEN1A*$PROD$PROD
l
m[MG][MG]
Köln (Cologne) | dgskorpus_koe_03 | 18-30m   The pants slid even lower to the upper leg.
rTHEN1A*$PROD
l
m[MG][MG]
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   I’ll pick them up at the main station, and they can get on the bus with me.
rI1MIDDLE2A^THEN1A*TO-PICK-UP1*TO-GET-IN1*
l
mbahnhofda{nn}abholen
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   I bought that additionally.
rTHEN1A*IN-ADDITION1$INDEX1*
l
mdazu[MG]
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   I’ll pack it into bags and knot them shut.
rTHEN1A*TO-PACK2*$PROD
l
m
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   It’s all mixed together and done.
r$INDEX1THEN1A*TO-THROW1^*TO-MIX3*DONE2
l
mfertig
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Then we need to think about how much we need and what we’ll order for New Year’s Eve.
rWE1B*THEN1A*HOW-MUCH5*HOW-MUCH5*PIECE3*
l
mwirdannwie vielestücke
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Up and back down.
rHIGH6*THEN1A*DOWN1*
l
mhochdann
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   I was surprised, white cabbage doesn’t fit.
rWHITE2ACABBAGE1*I1*THEN1A*TO-PUT-FROM-TO1A^*I1*$INDEX1*
l
mweißkohl
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   Carrots are in there, everything is mixed up and/
r$NUM-ONE-TO-TEN1B:4dCARROT3$PROD
lTHEN1A*MOST1A*
mdannmöhren[MG]meisten{s}
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   If I’m right, we can just go in as a group all relaxed, leaving our bathing suits on.
rIF-OR-WHEN1A*LAW-OR-JUSTICE1*THEN1A*LOOSE1*UNDERPANTS1*$GEST-OFF^*
l
mlocker
Köln (Cologne) | dgskorpus_koe_04 | 18-30f   One had to go up and down, driving to the hut on small paths.
r$PRODTHEN1A*WAY1*CABIN1*$INDEX1
l
m[MG]hütte
Köln (Cologne) | dgskorpus_koe_08 | 31-45m   I use a blunt screwdriver so as not to cut into everything.
rTHEN1A*SCREWDRIVER1*BLUNT1*
lBUT1*
mdannschraubenzieheraberstumpf
Köln (Cologne) | dgskorpus_koe_08 | 31-45m   Then, the surface gets roughened a little bit, not heavily though.
rTHEN1A*$INDEX1*TO-GRATE-OR-TO-RUB3PRESENT-OR-HERE1
l
mfeinda
Köln (Cologne) | dgskorpus_koe_08 | 31-45m   I usually always lay a heavy stone on top so it’ll stick better.
rTHEN1A*I1REGULAR4B*I2
l
mdann[MG]stamm
Köln (Cologne) | dgskorpus_koe_09 | 18-30f   After her death, her story was told in a movie.
rLIKE3B*$INDEX1*DEATH2THEN1A*MOVIE1HISTORY-OR-STORY1B*HISTORY-OR-STORY2
l
mwie[MG]schauspielergeschichte
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Now, Düsseldorf is claiming 260, yes, I think 260 euros. He’ll only be cleared to play after that’s been paid.
r$GEST-OFF^I1TO-PAY1*THEN1A*OFF1C
l
m[MG]dann[MG]
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Then the first two teams of the northern and southern group would play against each other.
rTHEN1A*I1NORTH1BGROUP1A*
l$INDEX1$INDEX1
mdannnordgruppe
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   That’s just like/
rTHEN1A*HERE1LIKE3A*$LIST1:1of1d*
l$INDEX1
mdannwie
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Then they have to drive quite far for the match for the German championship.
rTHEN1A*GERMAN1*CHAMPIONSHIP1*I1*
l
mdanndeutsche meisterschaft
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   And then they have another match on home ground and one on neutral grounds.
rTHEN1A*HOME1A*NEUTRAL1ATO-CRITICISE1B^*
l
mheimneutraleort
Köln (Cologne) | dgskorpus_koe_10 | 18-30m   Just imagine what it would be like if we had to drive all the way to Hamburg, and then there’s a home game.
rHAMBURG2*OUTWARDS1*THEN1A*HOME7
l
mhamburg[MG]heim
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   At some point I ended up at the women's soccer club in Bielefeld.
rI1*LATER10*I1THEN1A*LAST1ALADY1AFOOTBALL2
l
mdanndamenfußball
Köln (Cologne) | dgskorpus_koe_11 | 31-45f   I tried though and eventually it worked out pretty well.
rI1THEN1A*RIGHT-OR-AGREED1^*$INDEX1*TO-DEVELOP1A
l
m[MG]
Köln (Cologne) | dgskorpus_koe_13 | 61+m   And then/
r
lTHEN1A*
m
Köln (Cologne) | dgskorpus_koe_13 | 61+m   We also went to the German Championships for the Deaf with young people and adults.
rAND3*TOGETHER1A*CHAMPIONSHIP1
lTHEN1A*GERMAN1
mdeutsche meisterschaft
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   That's about it in my city.
rDONE2*$GEST-OFF^THEN1A*SOMEWHERE1^*NOT3A*SPECIAL-OR-PARTICULARLY5*
l
mfertigdannnichtbesonders
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   I have to look that up again.
rBAD-OR-STALE1*I1THEN1A*I1SHALL1*
l
mnicht schlechtdannmalsoll
Köln (Cologne) | dgskorpus_koe_15 | 31-45m   Afterwards we went to my place and they were hungry again. They didn't have to go to my mothers again.
rTHEN1A*EVENING2*TO-VISIT-OR-TO-ATTEND1B*HUNGER3
l
mbesuchhunger
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   I then met my wife, so I had a new focus/
rTHEN1A*BOYFRIEND-GIRLFRIEND1*$GEST-NM-NOD-HEAD1^$GEST-OFF^
l
mf{rau}
Köln (Cologne) | dgskorpus_koe_16 | 46-60f   Then/
rTHEN1ATHEN1A*
l
mdann
Köln (Cologne) | dgskorpus_koe_17 | 61+f   Then/
rTHEN1A*
l
m
Köln (Cologne) | dgskorpus_koe_17 | 61+f   So we took my sister to her home.
rTHEN1A*I1SISTER1A*TO-LET1^*
l
mdannmeinsch{wester}heim
Köln (Cologne) | dgskorpus_koe_17 | 61+f   There we waited for our teacher to come pick us up.
rTEACHER1THEN1A*I1ALL1A^*BACK1A*
lMY1*TO-COME1
mmeinlehrerkommtdannwirzurück
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   Then the second Culture Days in Munich/
rTHEN1A*$NUM-ORDINAL1:2dCULTURE1A*DAY1A
l
mdannzweitekulturtage
Köln (Cologne) | dgskorpus_koe_19 | 31-45f   And then I flew back home.
rTHEN1A*AWAY1*
l
mdannab
Köln (Cologne) | dgskorpus_koe_20 | 31-45m   I don't know the younger one, but the older one I do know. I've seen only a small part.
rTHEN1A*YOUNG1*TO-KNOW-STH-OR-SB1B*NAME1A
l
m[MG]jungken{nen} nichtalt
Köln (Cologne) | dgskorpus_koe_22 | 46-60m   Yes, right it was in January '91.
rJANUARY9A$NUM-ONE-TO-TEN1A:1d*$NUM-TENS2A:9*THEN1A*AFTERWARDS3FLOODWATERS1*VERY6^*
l
meinundneunzigdannschlimm
Köln (Cologne) | dgskorpus_koe_22 | 46-60m   Everybody had to shovel sand.
rTHEN1A*MUST1*$PROD$ALPHA1:S-A-N
l
m[MG]sand
Köln (Cologne) | dgskorpus_koe_22 | 46-60m   About four or five weeks later I visited Dresden.
rI2TO-LOOK-AT3THEN1A*WEEK1B*$NUM-WEEK-AFTER-NOW1:5LATER10
l
mdannvierfünf wo{chen}spä{ter}
Köln (Cologne) | dgskorpus_koe_22 | 46-60m   It‘s so easy to just hire an interpreter, though.
rTHEN1A*EASY1INTERPRETER1*TOGETHER-PERSON1^*
l
meinfachdolmetscher
Leipzig | dgskorpus_lei_01 | 18-30m   Right. You always have to instruct the interpreter first, whereas the assistant gets a lot from context.
rTO-HIRE1A*BEFOREHAND1TO-EXPLAIN1*THEN1A*TO-HIRE1A*BEFOREHAND1*TO-EXPLAIN1
l
mvorerklärennoch malvorerklären
Leipzig | dgskorpus_lei_03 | 18-30m   And then you‘re going to do your presentation on it?
r$GEST-OFF^
lTHEN1ALECTURE1THEN1A*
mdann[MG]
Leipzig | dgskorpus_lei_05 | 61+f   Then he grew up and was a great cat.
rTHEN1A*TO-GROW3SUPER1$GEST-OFF^*
l
mdannwachsensuper
Leipzig | dgskorpus_lei_08 | 46-60f   Then one could also use telegram. You've already mentioned it.
rPERIOD1A^*THEN1A*PERIOD1C^*MEANS1^
lYOU1*
mdutelegramm
Leipzig | dgskorpus_lei_08 | 46-60f   Later/
rTHEN1A*LATER10*
l$INDEX1*
mdannspäter
Leipzig | dgskorpus_lei_09 | 31-45f   After that, I was at the school for the deaf from first to tenth grade.
rTHEN1A*SCHOOL1A$INDEX1*$NUM-GRADE1:1*
l
mdannschuleklasseeins
Leipzig | dgskorpus_lei_09 | 31-45f   I was just standing there, turned around and suddenly my leg broke, just like that.
rWHERE1ATO-STAND1*LEG1A*THEN1A*$PRODTO-BREAK2*$GEST-OFF^
l
mwostehenund dann
Leipzig | dgskorpus_lei_11 | 31-45f   Then I was unemployed/
rTHEN1A*I1TO-WORK2*$MORPH-LESS1
l
marbeitslos
Leipzig | dgskorpus_lei_11 | 31-45f   One month after we had been discharged from hospital, we went to the hospital/
rI1HOSPITAL1BTO-DISMISS1THEN1A*MONTH1*THEN1A*I1*
l
mkrankenhausentlassenein monatdann
Leipzig | dgskorpus_lei_11 | 31-45f   One month after we had been discharged from hospital, we went to the hospital/
rTO-DISMISS1THEN1A*MONTH1*THEN1A*I1*HOSPITAL1B$INDEX1
l
mentlassenein monatdannkrankenhaus
Leipzig | dgskorpus_lei_11 | 31-45f   Yes, that's just the way he grew up and I can say that he really is a great boy.
rTHEN1A*TO-GROW-UP1A$GEST-OFF^*$ORAL^
l
mundaufwachsenaber
Leipzig | dgskorpus_lei_12 | 61+m   Well, the thing with the school worked out and then/
r$GEST-NM-NOD-HEAD1^GOOD1IT-WORKS-OUT1THEN1A*$INDEX1
l
m[MG]gutklappenund dann
Leipzig | dgskorpus_lei_13 | 46-60m   We were learning the whole day. After our volleyball practice, during dinner, we turned on the TV.
rVOLLEYBALL1A*WHISTLE1*THEN1A*EVENING2VOLLEYBALL1A*WORKOUT1
l
mdanna{bend}volleyballtraining
Leipzig | dgskorpus_lei_13 | 46-60m   They called someone.
rTHEN1A*PHONE1*DONE4*
l
m
Leipzig | dgskorpus_lei_14 | 31-45m   And there’s also an autograph session with the stars that’s included.
rINVOLVED1A*$INDEX1CELEBRITY1
lTHEN1A*
mmitstar
Leipzig | dgskorpus_lei_15 | 18-30f   Then we went on.
rTHEN1A*$GEST-OFF^MASS-OF-PEOPLE-ACTIVE2*
l
m[MG]
Leipzig | dgskorpus_lei_15 | 18-30f   And in the afternoon the Sign Language Festival started.
rTHEN1A*AFTER3BEARLY1A^*$INDEX1
l
mdannnachmittag
Münster | dgskorpus_mst_01 | 46-60m   The deaf children can sign with each other then; this could work.
rTHEN1A*TO-UNDERSTAND1^*DEAF1A*GROUP1A*
l
mdannsowieso
Münster | dgskorpus_mst_02 | 18-30f   Behind that, there’s another bar in a different room.
r
lTHEN1A*UNDER1A^ANOTHER1$NUM-ONE-TO-TEN1A:1d
mdanndanochein
Münster | dgskorpus_mst_03 | 18-30f   Still, if you have practiced hearing for years, it isn't easy at all not being able to do so anymore.
rNEVERTHELESS2A*YEAR2BTHEN1A*NOT-ANYMORE1A
lTO-PERCEIVE-EAR1^BURDEN2
mtrotzdemein jahrdannnich{t} mehr[MG]
Münster | dgskorpus_mst_04 | 31-45m   Through those two groups of people coming together, conflicts arose.
rTO-AFFECT1*CONFLICT1E$GEST-OFF^
lTHEN1A*
mdanneinflusskonflikt
Münster | dgskorpus_mst_04 | 31-45m   It only happened once a year, that bananas were delivered/
rYEAR3B*THEN1A*ONCE-MORE2A*ONCE-MORE1ABANANA2*
l
mein jahrwied{er}banane
Münster | dgskorpus_mst_06 | 31-45m   Then you need fresh oil.
rFRESH1TO-TAKE-OFF-OBJECT1*
lTHEN1A*
mdannfrisch[MG]
Münster | dgskorpus_mst_06 | 31-45m   Then, the rubber is placed onto the filter.
rRUBBER1*ON1A*$PROD
lTHEN1A*
mdanngummiauf
Münster | dgskorpus_mst_06 | 31-45m   The car is brought back down, but it’s not done yet.
r$PRODDONE2*
lTHEN1A*NO1A
m[MG]dannfert{ig}nein
Münster | dgskorpus_mst_06 | 31-45m   During my second trip my foot was fine, but when I got back, it had swollen up.
rI1$LIST1:2of2dTHEN1A*$INDEX1TO-VISIT-OR-TO-ATTEND1B*$INDEX1
l$INDEX1
mdannbesuchtkein problem
Münster | dgskorpus_mst_06 | 31-45m   It rains for six months, then the next six months are very hot, always in turns.
rMONTH1*RAIN1A*TIME5B*THEN1A*MONTH1*$PRODDISTINCT1
l
msechs monateregenzeitsechs monate[MG]verschieden
Münster | dgskorpus_mst_08 | 61+f   You don’t get up until 11 a.m. or noon, then you eat breakfast late and go back to bed.
rBREAKFAST1LATER9B*TO-EAT-OR-FOOD1THEN1A*BED1B
l
mfrühstückspät
Münster | dgskorpus_mst_10 | 46-60f   Somebody gets one task and the next person gets another task that God sent him.
rTASK1BHIS-HER1*UNDER1A^*THEN1A*TO-GIVE1*PROPHET-$CANDIDATE-MST11^*
l
maufgabedannsenden
Münster | dgskorpus_mst_10 | 46-60f   And then I found something.
rTHEN1A*I1TO-FIND1B$INDEX1
l
mgefunden
Münster | dgskorpus_mst_10 | 46-60f   I have to feel really comfortable and then/
rWELL1*$INDEX1*HIS-HER1*THEN1A*
l
mwohldann
Münster | dgskorpus_mst_11 | 61+m   Then I walked to school with my friends.
rWE1A*ALL2BTO-ACCEPT-STH3A*THEN1A*FRIEND7SCHOOL1CWAY2B
l
malledann[MG]schulweg
Münster | dgskorpus_mst_12 | 31-45m   And then there really was an earthquake.
rTHEN1A*THERE-IS4REALLY2
l
mgibt
Münster | dgskorpus_mst_13 | 46-60f   Then the lunar module/
rTHEN1A*$PROD
l
mdann
Münster | dgskorpus_mst_13 | 46-60f   When he let go of the ladder and jumped down, you couldn't see him in this camera perspective anymore.
rTHEN1A*$PRODTO-THROW1^*TO-SEE1
l
mlos
Münster | dgskorpus_mst_13 | 46-60f   You couldn't see him anymore until he started jumping around the lunar module.
rTHEN1A*UNTIL1*TO-MAKE2*TO-RUN8*
l
mauf einmal
Münster | dgskorpus_mst_15 | 31-45f   Then, it was Christmas Eve.
rTHEN1A*SUDDENLY4*CHURCH1*HOLY1A
l
m[MG]heiligabend
Münster | dgskorpus_mst_15 | 31-45f   I still get the support for the First Communion of #Name1.
r$INDEX1*COMMUNION1$INDEX1*THEN1A*TO-SUPPORT4YES2
l
mkommunion[MG][MG]ja
Münster | dgskorpus_mst_16 | 61+m   Then, we were supposed to go to the foster home.
rTHEN1A*TO-COME2*WRINKLE-CHEEK1A^*HOUSE1A*
l
mdannkommtpflegehaus
Münster | dgskorpus_mst_16 | 61+m   Five more years.
rOUTDOORS1A^*THEN1A*$INDEX1TO-COME-FROM1*SCHOOL1C*
l
mfünf jahredannkomm noch
Münster | dgskorpus_mst_16 | 61+m   Then, in grade seven, the class got better and better.
rTHEN1A*$NUM-ORDINAL1:7dCLASS2$INDEX1*
l
m[MG]siebteklasse[MG]
Münster | dgskorpus_mst_16 | 61+m   He had a few questions.
rTHEN1A*TO-LIST1A
l
mdann[MG]
München (Munich) | dgskorpus_mue_01 | 61+f   What else?
rTHEN1A*
l
m
München (Munich) | dgskorpus_mue_01 | 61+f   We’re going to go on some excursions soon.
r$INDEX1THEN1A*TRIP4*
l
m[MG]
München (Munich) | dgskorpus_mue_03 | 46-60m   Later I read it somewhere on a website and it was true.
rTHEN1A*LATER2I2*INTERNET1C
l
mdannspäterichinternet
München (Munich) | dgskorpus_mue_03 | 46-60m   My mother wasn’t at home because she had to work.
rTHEN1A*MUM3*NOT6PRESENT-OR-HERE1*
l
mdannmamanichtda
München (Munich) | dgskorpus_mue_03 | 46-60m   We went on our trips during the day and at night we went to the bar.
rUNTIL-TODAY1BTHEN1A*TO-SWARM1^*TRIP4*PROGRAM1A
l
mbisdannausflugsprogramm
München (Munich) | dgskorpus_mue_03 | 46-60m   We went on our trips during the day and at night we went to the bar.
rTRIP4*PROGRAM1ADONE1B*THEN1A*EVENING2UNDER1A^ALCOHOL1^
l
mausflugsprogrammfertig fertig fertigdannabendimbar
München (Munich) | dgskorpus_mue_03 | 46-60m   After, we went back home.
rDONE1A*THEN1A*BACK2*BACK2*DONE1A
l
mfertigdannwiederwieder zurückfertig
München (Munich) | dgskorpus_mue_03 | 46-60m   Well, and then/
rPROCEEDING2THEN1A*$GEST^
l
m[MG]dann
München (Munich) | dgskorpus_mue_03 | 46-60m   Sometimes on the weekends I went swimming in the stream with my brother.
rTHEN1A*SOMETIMES2*I1TO-SWIM1*
l
mdannmalschwimmen
München (Munich) | dgskorpus_mue_03 | 46-60m   And then, all of a sudden, he is dead.
rAND2A*THEN1A*TO-DIE2*$GEST^$GEST^
l
munddanngestorben
München (Munich) | dgskorpus_mue_03 | 46-60m   Will there ever be a deaf person like him again?!
rTHEN1A*LIKE-THIS1A$NUM-ONE-TO-TEN1A:1dPERSON1^
l
mdannsoeinetyp
München (Munich) | dgskorpus_mue_03 | 46-60m   I also drove the tractor.
rMUST1*TRACTOR1*$GEST^THEN1A*
l
mmusstraktor fahrendann
München (Munich) | dgskorpus_mue_03 | 46-60m   I did my apprenticeship close to Munich.
rTHEN1A*$GEST^THEN1AI1
l
m
München (Munich) | dgskorpus_mue_03 | 46-60m   When I applied for the job, there only was a social worker with me.
rTHEN1A*I1PICTURE3^*TO-WORK2
l
mdannichaarbeit
München (Munich) | dgskorpus_mue_03 | 46-60m   A deaf couple from my area was also working there.
rTHEN1A*ALSO1A*$NUM-ONE-TO-TEN1A:1DEAF1A*
l
mdannaucheingehörloses
München (Munich) | dgskorpus_mue_03 | 46-60m   We started talking and getting to know each other and I joined a deaf club.
rI1TO-SWARM1*TALK3*THEN1A*I1*CONTACT3*CLUB-OR-SOCIETY2A*
l
munddau{nterhalten}dannverein
München (Munich) | dgskorpus_mue_03 | 46-60m   At first, I was in the deaf sports club and had my friends there, but later I joined the deaf club.
rTHEN1A*FIRST1ASPORTS1*CLUB-OR-SOCIETY2A*
l
mdannzuerstsportverein
München (Munich) | dgskorpus_mue_03 | 46-60m   That’s why I’m more focused on my work within the deaf club right now; I’ve reduced the work with my parents.
rTHEN1A*I1*PROCEEDING2*NOW2*
l
mabjetzt
München (Munich) | dgskorpus_mue_03 | 46-60m   When I got a new work position, I moved to Passau.
rI1*THEN1A*I2APARTMENT1A*TO-MOVE1
l
mdannwohnungumgezogen
München (Munich) | dgskorpus_mue_03 | 46-60m   After my birth they discovered that I couldn’t hear anything.
rTHEN1ATHEN1A*$GEST-OFF^TO-SMOKE1A^*BIRTH2*
l
mdanndanngeburt
München (Munich) | dgskorpus_mue_03 | 46-60m   A few members of our Sign choir “Singende Hände” [“Singing Hands”] agreed that we wanted to take a trip to Rome at some point, too.
rTO-COME-INTO-MIND1*MUST1A^*I1THEN1A*I1TO-LIKE4$ORAL^
l
m[MG]warichdannichwillauch
München (Munich) | dgskorpus_mue_03 | 46-60m   So we booked a flight.
rTHEN1A*AIRPLANE2A*TO-BOOK1TO-LET-KNOW2^*
l
mdannflugmitgebucht
München (Munich) | dgskorpus_mue_03 | 46-60m   On Monday we had some plans.
rTHEN1A*MONDAY5AEXAMPLE1*TIME1^*
l
mdannmontag[MG]programm
München (Munich) | dgskorpus_mue_03 | 46-60m   We got along really well because we already worked together on the training of sign language teachers at the University in Frankfurt.
rINVOLVED1A*$INDEX1INVOLVED1ATHEN1A*
l
mdabei{da}beidann
München (Munich) | dgskorpus_mue_03 | 46-60m   Then we applauded.
rTHEN1A*APPLAUSE1
l
mund dann
München (Munich) | dgskorpus_mue_03 | 46-60m   There was a meeting of with all deaf believers the next day.
rNEXT1DAY1ATHEN1A*TOGETHER1A*TO-MEET2A*DEAF1A*
l
mam nächstentagdannzusammentreffen
München (Munich) | dgskorpus_mue_04 | 18-30f   We like to rent a car at the car rental there every once in a while.
rTHEN1A*$PROD$INDEX1GLADLY1
l
mdanngern
München (Munich) | dgskorpus_mue_04 | 18-30f   We go see the different sights and we relax and have a good time for the rest of the time.
r$PRODTO-LOOK1*TO-LOOK-AT4^*THEN1A*DONE1A*REMAINS1B*ALL2A^
l
m[MG]schauenrest
München (Munich) | dgskorpus_mue_04 | 18-30f   If you continue walking, you'll walk past the Disney Studios and right next to those are the different rides.
rTHEN1A*LOCATION1A^*$INDEX1FOR1
l
m[MG]für
München (Munich) | dgskorpus_mue_04 | 18-30f   Then I was in their second capital Osaka.
rTHEN1A*THERE1*FIRST1A*$MORPH-MAIN1A
l
m[MG][MG]zuersthauptstadt
München (Munich) | dgskorpus_mue_05 | 61+f   They were out and about a lot and then/
rJOURNEY1A*TO-DRIVE-$CANDIDATE-MUE81^END1^*THEN1A*
l
m[MG]
München (Munich) | dgskorpus_mue_06 | 18-30f   In ten years we can ask those people what they think about it.
rTHEN1A*TO-SEE1*TO-DEVELOP1A$NUM-YEAR-AFTER-NOW1:10*
l
mzehn jahr
München (Munich) | dgskorpus_mue_07 | 18-30m   The Nymphenburg Palace.
rTHEN1A*$LIST1:3of3dTO-CLOSE2C
l$INDEX1
mdannschlo{ss}
München (Munich) | dgskorpus_mue_07 | 18-30m   Then/
rTHEN1A*
l
m
München (Munich) | dgskorpus_mue_07 | 18-30m   With time, it changed and became more modern.
rTO-DEVELOP1A
lTHEN1A*MODERN1A
mmodern
München (Munich) | dgskorpus_mue_09 | 61+f   There was something else in there that was interesting.
rTHEN1A*$INDEX1INTEREST1A*
l
m[MG][MG]
München (Munich) | dgskorpus_mue_10 | 31-45m   In 1956, there were only boys in Augsburg.
rTHEN1A*OUTDOORS1A^*AUGSBURG2*$INDEX1
l
mdanna{ugsburg}
München (Munich) | dgskorpus_mue_10 | 31-45m   In the beginning, he hit me once, then more and more.
r$NUM-ONE-TO-TEN1A:1d*TO-BEAT4*$LIST1:2of2dTHEN1A*ALWAYS3MORE1*TO-BEAT4*
l$NUM-ONE-TO-TEN1A:3d$NUM-ONE-TO-TEN1A:4d
meinmaldannimmermehr[MG]
München (Munich) | dgskorpus_mue_10 | 31-45m   She went round the house, and came up to me.
rTO-GO2A*
lTHEN1A*
m[MG]
München (Munich) | dgskorpus_mue_11 | 31-45f   Next is eyeshadow, eyeliner and mascara.
rEYELID1*COLOUR1A*THEN1A*MASCARA1*$PROD$INDEX1*
lTHEN1A
mdannfarbedann
München (Munich) | dgskorpus_mue_11 | 31-45f   And then the lipstick.
rTHEN1A*DONE1A*
lLIPSTICK1
mdannlippenstift
München (Munich) | dgskorpus_mue_11 | 31-45f   That’s where I’ll keep my wallet, glasses, sh/ lipstick and mobile.
rTHEN1A*MONEY1A*TO-PACK2*GLASSES1B*
l
mgeldbeutelbrille
München (Munich) | dgskorpus_mue_11 | 31-45f   It was an interesting story, as they later/
rINTEREST1BHISTORY-OR-STORY2*THEN1A*FUTURE1B^*
l$GEST-TO-PONDER1^
mint{eressant}
München (Munich) | dgskorpus_mue_12 | 46-60f   Inside, there is a sign which says “Read good books“, that’s important.
rTHEN1A*SIGN1GOOD1BOOK1B
l
m[MG]gutebücher
München (Munich) | dgskorpus_mue_12 | 46-60f   Afterwards, the two of them go into the bathroom.
rTHEN1A*BOTH2A*TO-BATH1BTO-GO-THERE1
l
mdannbeidebad
München (Munich) | dgskorpus_mue_12 | 46-60f   And then, normally, the son would have to go take a bath.
rTHEN1A*USUALLY1*SON1$PROD
l
mdannnormalerweisesohn[MG]
München (Munich) | dgskorpus_mue_13 | 46-60m   Next, we needed to make reservations for a room.
rTO-LET1^THEN1A*ROOM1BTO-MAKE-RESERVATIONS1
l
mraum
München (Munich) | dgskorpus_mue_13 | 46-60m   Afterwards, I only heard good things about the Culture Days from other people.
rTHEN1A*ALREADY1A*PERCEPTION1*$INDEX1
l
mdannschonhamburg
München (Munich) | dgskorpus_mue_13 | 46-60m   I then entered second grade and everything stayed the same.
rTO-WALK-AROUND1*$NUM-ORDINAL1:2dTHEN1A*STEP1^
l
mzweidann
München (Munich) | dgskorpus_mue_13 | 46-60m   I watched a lecture on the subject of family. What else?
rFAMILY1I1TO-GO-THERE1THEN1A*
l
mfamilie
München (Munich) | dgskorpus_mue_13 | 46-60m   I gave in and started the job training.
r$GEST-NM^TO-ACCEPT-STH3ATO-JOIN1A^*THEN1A*EDUCATION1*TO-JOIN1A^*
l
mdannausbildung
München (Munich) | dgskorpus_mue_13 | 46-60m   Every time I went home, she asked whether it was going well.
rI1*THEN1A*END1^*HOME6*MOTHER1*
l
mdannheimmutter
München (Munich) | dgskorpus_mue_13 | 46-60m   On the last day of these two weeks we were called up in alphabetical order to be told how each of our tests went.
rPROCEEDING1A*DONE1ATHEN1A*$NUM-ONE-TO-TEN1A:3d*LAST1BUNTIL-TODAY1B^*
l
mletzt
München (Munich) | dgskorpus_mue_13 | 46-60m   The first person to ask me a question was the job centre employee.
r$INDEX1*$INDEX1THEN1A*$INDEX1QUESTION1*TO-WORK2*
l
mdannfragearbeitsamt
München (Munich) | dgskorpus_mue_13 | 46-60m   Then it was the principal’s turn.
rTHEN1A*CLUB-OR-BAT1B^SCHOOL1C*MASTER1^
l
mschuldirektor
München (Munich) | dgskorpus_mue_13 | 46-60m   In the end only the interpreter remained, so I had made it.
rTHEN1A*INTERPRETER2*THANK-YOU-ASL1^*TO-ACCOMPLISH1C*
l
mdanndolme{tscher}schaff
München (Munich) | dgskorpus_mue_13 | 46-60m   Then the training started.
rTHEN1A*I1*TO-DRIVE1*GO-START1
l
mlos
München (Munich) | dgskorpus_mue_13 | 46-60m   When I graduated, they finally told me. I had my certificate, so I couldn’t care less.
rGRADUATION-OR-COMPLETION1TO-LET-KNOW1A*INTEREST1ATHEN1A*TO-HOLD-PAPER1A^*$GEST-DECLINE1^*$INDEX1*
l
mabschluss
München (Munich) | dgskorpus_mue_13 | 46-60m   By the end of the break, the new interpreter came to my training centre. First thing I did was greet him.
rEDUCATION1*IMPORTANT1^*TO-FALL3^*THEN1A*GO-START1*INTERPRETER1*TO-HIRE1A*
l
mausbildungferienendedannlosdolmetscher
München (Munich) | dgskorpus_mue_13 | 46-60m   It was only then that the principal told me that half a year before, the health department had wanted to kick me out.
rTHEN1A*I2*WHAT1B*PERCEPTION1^*
l
mund dannbekommen
Rostock | dgskorpus_mvp_01 | 18-30m   That’s because you have to pay for the surgery, so you don’t have to pay the rest.
rOPERATION1CTO-MAKE2*TO-PAY1THEN1A*FREE4TO-PAY1$GEST^
l
moperationmachbezahlendannfreibezahl
Rostock | dgskorpus_mvp_01 | 18-30m   If everyone wants to do it, you just pick a particular date and go demonstrate.
rTHEN1A*APPOINTMENT1AWHATEVER3*
lTO-WANT2THEN7*
mwilldannterminegaldann
Rostock | dgskorpus_mvp_01 | 18-30m   And then continue with words.
rSIGN-LANGUAGE1B
lTHEN1A*WORD1*
mdanngebärdensprachewort
Rostock | dgskorpus_mvp_02 | 31-45m   I took the train to Rostock. There, I changed from train to car.
rTRAIN2B*JOURNEY3*DONE2*THEN1A*CAR3TO-PICK-UP1THEN1A*
lTHERE1
mzugautodannautoab{holen}
Rostock | dgskorpus_mvp_02 | 31-45m   I took the train to Rostock. There, I changed from train to car.
rTHEN1A*CAR3TO-PICK-UP1THEN1A*TRAIN2B*CAR-DRIVING2*
l
mdannautoab{holen}
Rostock | dgskorpus_mvp_02 | 31-45m   It usually takes four hours to get there.
rTHEN1A*AIM2*ACTUALLY1BHOUR2B*
l
mdannzielei{gentlich}vier stunden
Rostock | dgskorpus_mvp_05 | 61+m   Our foreman protested, because deaf people didn’t get any medals. The next year, we deaf people also got awards.
rCAN2A*HIGH5BTO-OBTAIN2*
lMEDAL1B*THEN1A*ALSO3A*DEAF1A
mkann nichthochmedaillenächstes jahrbekommenauch
Rostock | dgskorpus_mvp_05 | 61+m   And people who were party members were then allowed to work as a foreman.
rFIRST1BPARTY-POLITICAL1*MEMBER2*THEN1A*ALLOWED1*MASTER3TO-APPOINT-SB1A
l
merstparteimitglieddanndarfmeister
Rostock | dgskorpus_mvp_07 | 31-45f   Surprisingly, not so long ago they told me that it might work out after all.
r$GEST-DECLINE1^*THEN1A*SOON1*RECENTLY1SURPRISE1*
l
maber[MG][MG]überraschung
Rostock | dgskorpus_mvp_07 | 31-45f   Though, it was only an extension for half another year.
rTHEN1A*EXTENSION1BHALF-A-YEAR1*EXTENSION1B
l
m[MG]verlä{nger}unghalbverlä{nger}ung
Rostock | dgskorpus_mvp_07 | 31-45f   They have to wear gloves, a work coat, work pants, shoes and a hairnet.
rJACKET1SHOE5AMOUTHPIECE1*THEN1A*WOOLLEN-CAP-OR-CAP1YES2*
l
mjackeschuhhaub[MG]
Rostock | dgskorpus_mvp_08 | 46-60m   At the Spartakiad in Dresden, for example, or at other places.
rTHEN1A*ATHLETICS1$GEST-OFF^IN1
l
mdannspartakiadein
Rostock | dgskorpus_mvp_08 | 46-60m   But they don’t love each other.
rTHEN1A*TO-FALL-IN-LOVE1*$GEST-OFF^
l
mda{nn}lieben
Rostock | dgskorpus_mvp_08 | 46-60m   Then, there was a heat.
rTHEN1A*BEFORE2TO-RUN1
l
mvorlauf
Rostock | dgskorpus_mvp_08 | 46-60m   But I only joined them after the holidays were over.
rMOST1AHOLIDAYS2*END1ATHEN1A*I1HEARING1B*I2
l
mmeistferiendannhörend
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   After that we went home and back to the club in Nuremberg.
rTHEN1A*TO-COME1^$INDEX1
l$INDEX1
mheim
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   Some talks were given and honors were awarded.
rTHEN1A*LECTURE1MUCH-OR-MANY1ADAUGHTER1^
l$NUM-ONE-TO-TEN1A:1d
mdannvortragvieleehrung ehrung
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   Shortly after that he died and it was said it wasn't a goal at all.
rTHEN1A*SOON7*TO-DIE2*TO-SAY1
l
mdannbaldgestorbensag
Nürnberg (Nuremberg) | dgskorpus_nue_01 | 61+m   I also had a selling stand there once and sold things.
rAREA1DTO-HAVE-TO-OWN1$INDEX1THEN1A*I2TO-SELL1
l
mgehabtdannverkauf</